KEGG   Cupriavidus metallidurans: Rmet_1156Help
Entry
Rmet_1156         CDS       T00351                                 

Gene name
bdhA
Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00072  Synthesis and degradation of ketone bodies
rme00650  Butanoate metabolism
rme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rmet_1156 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Rmet_1156 (bdhA)
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Rmet_1156 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR AdoHcyase_NAD ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ABF08042
JGI: Rmet1156
UniProt: Q1LP84
Position
complement(1265104..1265880)
Genome map
AA seq 258 aa AA seqDB search
MLKGKTALVTGSTSGIGLGIAQALAAQGANIIVNGFGDVDGAKAEIAKSGSGIQVGYHGA
DMSKAAEIEDMMRYAEKDFGGVDILVNNAGIQFVAKIEEFPVDRWDAIIAINLTSAFHTT
RLALPSMKAKNWGRVINIASTHGLVASAEKSAYVAAKHGIVGFTKVTALETAQTGVTANA
ICPGWVLTPLVQKQVEARAQKEGIPVEQAKRELVIEKQPSGQFVTPEELGALAVFLSSEA
ARQVRGAIWNMDGGWVAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaggcaagacggcactggtcactggatcgaccagcggtatcggactcggcatc
gcccaagcgctagccgcgcaaggtgcgaacatcattgtcaacggattcggtgacgtggac
ggcgcaaaggcggagatcgccaaatccggcagcggcattcaggttggctaccacggcgcc
gacatgagcaaggctgccgagatcgaggacatgatgcgctatgccgagaaggacttcggc
ggcgtggacatcctggtcaataacgcaggcatccagttcgtggcgaagatcgaggaattt
ccggtcgatcgctgggacgcgatcatcgccatcaatctcacctccgcattccacaccacc
cgcctggccctgccctcgatgaaggcgaagaactgggggcgggtcatcaatatcgcctcg
acccacggtctcgtggcatcggcggaaaagtcggcctacgtggccgcgaaacacggcatc
gtcggcttcaccaaggtcaccgcgctcgaaacggcgcagaccggcgtcacggccaatgcc
atctgcccgggctgggtgctgacgccactggtacagaagcaggtggaagcccgcgcccag
aaggaagggattccggtcgagcaagccaagcgcgaactggtgatcgagaagcagccttcc
ggccagttcgtcacgcccgaggaactcggcgcgctggcggtgttcctgtcgagcgaagcc
gcgcgtcaggtgcgcggcgcgatctggaacatggacggcggctgggtggcccaataa

DBGET integrated database retrieval system