KEGG   Cupriavidus metallidurans: Rmet_1197Help
Entry
Rmet_1197         CDS       T00351                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rme  Cupriavidus metallidurans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rme01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rme00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rme00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rme00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1315368..1317032
Genome map
AA seq 554 aa AA seqDB search
MSQAIEIKVPDIGDYDAVPVIEVHVKPGDTINAEDALVTLESDKATMDVPSPQAGTVKEV
RIKVGDSVSEGSVLVMLEPAGAAAAAPAPAAAAAPAAPAPAAAAPAPAAPAAPAPAAAPA
GGGTVEVKVPDIGDYDAVPVIEIHVKVGDQINAEDALVTLESDKATMDVPSPQAGTVKEI
KVKVGDNVAQGTLILILEAAGGAAAAAPAPAAAPAPAAAAPAPAPAAAAPAPVAAPAVAP
AVQGTTGKAAHASPTVRKFARELGVDVSRVPGTAPKGRITQEDVQNYVKSVMSGQTATPS
APAAAAGTGVGLDLLPWPKVDFTRFGEVESKPLSRIKKISGANLHRNWVMIPHVTNCDEA
DITELEAFRVQLNKENEKAGIKVTMLAFMIKATVAALKKFPNFNASLDGDNLVLKKYFNI
GFAADTPNGLVVPVIKDADKKGVLEISQEMSDLAKLARDGKLKPDQMQGGCFSISSLGGL
GGTYFTPIINAPEVAIMGVCKSYMKPVWDGKQFAPRLTLPLSLSWDHRVIDGAEAARFNT
YFAALLADFRRILL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgattgaaatcaaggtgccggatatcggcgactacgacgccgttcccgtc
atcgaagtgcacgtgaagccgggcgacacgatcaacgcggaagacgcgctggtgacgctg
gaatccgacaaggccaccatggacgtgccgtcgccgcaggccggcacggtcaaggaagtc
cggatcaaggtgggcgatagcgtttccgaaggctccgtgctggtgatgctcgagcccgca
ggcgccgctgccgccgctccggctcccgcagccgctgctgctccggcagctccggcccct
gccgccgcggcacccgcgccggcggctcccgctgccccggctccggccgctgcccctgct
ggtggtggcacggtcgaggtcaaggtgcccgatatcggcgactacgacgccgtgccggtc
atcgaaatccacgtcaaggtgggtgaccagatcaacgccgaagacgcgttggtgacgctg
gagtccgacaaggccaccatggatgtgccgtcgccgcaggccggcacggtcaaggaaatc
aaggtcaaggtcggtgataacgtcgcccaaggcacgctgatcctgatcctggaagctgct
ggcggcgctgccgcagcagctccggccccggcagccgccccggcgcctgccgcagccgct
cccgcgcccgcaccggcggccgcggcgccggcacctgttgccgcgccggccgtcgcgcca
gcggtgcagggtacgaccggcaaggccgctcacgccagcccgaccgtgcgcaagttcgcg
cgcgagctgggtgtcgacgtgtcgcgtgtgccgggcaccgctcccaagggccgcatcacg
caggaagacgtgcagaactacgtcaagagcgtcatgagcggccagactgccacgccgtcc
gcaccggctgccgccgccggcaccggcgtgggcctggacctgctgccgtggccgaaggtg
gacttcacgcgctttggcgaagtggagtcgaagccgctgtcgcgcatcaagaagatctct
ggcgccaacctgcatcgcaactgggtcatgatccctcacgtcacgaactgtgacgaagcg
gacatcaccgagctcgaggcattccgcgtgcagctcaacaaggaaaacgagaaggctggc
atcaaggtgacgatgcttgcgttcatgatcaaggccaccgttgcggcgctcaagaagttc
ccgaacttcaacgcctcgctggacggcgacaacctggtgctgaagaagtacttcaacatc
ggtttcgcggccgacaccccgaacggtctggtcgtgccggtgatcaaggacgccgacaag
aagggcgtgctcgagatcagccaggaaatgagcgatctggccaagctggcgcgcgacggc
aagctgaagcctgaccagatgcaaggcggctgcttctcgatctcgtcgctcggcggcctc
ggtggcacgtacttcacgccgatcatcaatgcgccggaagtggccatcatgggcgtgtgc
aagtcgtatatgaagccggtgtgggacggcaagcagttcgccccgcgcctgacgctgccg
ctgtcgctgtcgtgggatcaccgcgtgatcgacggtgccgaggccgcacgcttcaacacg
tacttcgcggcgctgctggcggatttccgccggattctgctgtaa

DBGET integrated database retrieval system