KEGG   Cupriavidus metallidurans: Rmet_1320Help
Entry
Rmet_1320         CDS       T00351                                 

Gene name
mhpF
Definition
(GenBank) Acetaldehyde-CoA dehydrogenase II, NAD-binding (protein belongs to CMGI-2)
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00362  Benzoate degradation
rme00620  Pyruvate metabolism
rme00621  Dioxin degradation
rme00622  Xylene degradation
rme00650  Butanoate metabolism
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01220  Degradation of aromatic compounds
Module
rme_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rmet_1320 (mhpF)
   00650 Butanoate metabolism
    Rmet_1320 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_1320 (mhpF)
   00622 Xylene degradation
    Rmet_1320 (mhpF)
   00621 Dioxin degradation
    Rmet_1320 (mhpF)
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Rmet_1320 (mhpF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Rmet_1320 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DUF2642
Motif
Other DBs
NCBI-ProteinID: ABF08203
JGI: Rmet1320
UniProt: Q1LNS3
Position
complement(1433845..1434756)
Genome map
AA seq 303 aa AA seqDB search
MKKIKCALIGPGNIGTDLLAKLKRSSVLEPVWMVGIDPESEGLNRARELGIKTTAEGVDG
LLPHVLADGVQIAFDATSAYVHAENARKLNALGVMMIDLTPAAIGPYCVPPVNLKEHLGK
REMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSRSVGPGTRKNIDEFTRTTAGA
VEKVGGARKGKAIIIINPAEPPLMMRDTIHCLTETEPDQQRIAESIHAMIEEVQKYVPGY
RLVNGPVFDGKRVTVFMEVAGLGDYLPTYAGNLDIMTAAAARTAEMFAEEMIAGNLTLEP
VVA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcaaatgtgcgctgatcggaccaggcaatatcggcaccgatctgctggcc
aagctcaagcgcagctcggtgctggagccggtgtggatggtgggcatcgacccggaatcg
gaggggctgaaccgagcccgtgagctcggcatcaaaaccacggcggaaggtgtcgacggg
ctgctgccgcatgtgctggccgatggtgtgcagatcgcgtttgatgccaccagtgcatat
gttcacgcggaaaacgcgcgcaagcttaacgcgctgggcgtgatgatgatcgatctgacg
ccggcggcaattggcccgtactgcgtaccgccggtcaatttgaaagagcacctgggcaaa
cgcgagatgaatgtaaacatggtcacctgtggcgggcaggccaccattccgatggtcgct
gcggtctcgcgcgtgcagccggtcgcttacggagaaatcgtcgcgaccgtatcgagccga
tcggtggggcccggcacgcgcaaaaacattgacgaattcacgcggaccacggccggcgcg
gtggaaaaggtggggggcgcgaggaagggcaaagccatcatcatcatcaacccggcggag
cctccgctgatgatgcgcgacacgattcattgcctgaccgaaaccgagccggatcagcaa
aggattgccgagtccatccacgccatgatcgaagaggtccagaagtacgtgcccggttac
cggctggtcaacggcccggtgtttgacggcaagcgtgtgacggtcttcatggaggtggcg
ggcctgggggactatctgcccacgtacgccggcaacctggacatcatgaccgctgccgcg
gcccggaccgccgagatgtttgccgaagagatgattgccggcaatctcacgctcgaaccg
gttgtcgcttga

DBGET integrated database retrieval system