KEGG   Cupriavidus metallidurans: Rmet_1385Help
Entry
Rmet_1385         CDS       T00351                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00630  Glyoxylate and dicarboxylate metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01200  Carbon metabolism
Module
rme_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rmet_1385 (aceA)
Enzymes [BR:rme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rmet_1385 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABF08268
JGI: Rmet1385
UniProt: Q1LNK8
Position
1493756..1495051
Genome map
AA seq 431 aa AA seqDB search
MTSRQQQIEALQKDWDTNPRWKGVKRNFTAEDVVRLRGSVQIEHTLARRGAEKLWHLLNT
EPFVNTLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPMVVK
RINNTFQRADQIQWSEGKGDIDYFAPIVADAEAGFGGVLNAFELMKSMIDAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAVAKLTAARLAADVSGVPTLVIARTDAEAADLVTSDVDE
RDQPFLTGERTVEGFFRSKPGIEQSIARALAYAEVADLVWCETGKPDLEFAKRFAQAVHA
KFPGKLLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHSLNYSMFNLAH
GYARNQMSAFVELQEAEFAAAEKGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTALKGST
EDEQFFEKKVA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgcgccaacaacagattgaagccctgcagaaggattgggacaccaatccacgc
tggaagggtgtgaagcgcaacttcaccgccgaagatgtggttcgtctgcgcggctcggtc
cagatcgagcacacgctggcccgccgcggcgcggaaaaactctggcacctgctgaacacc
gagccgttcgtcaacacgctcggcgcgctgacgggcaatcaggccatgcagcaggtcaag
gccggtctgaaggccatctacctgtcgggctggcaagtcgctggcgacgccaatctggcc
ggcgaaatgtaccccgaccagtcgctgtacccggccaactcggtgccaatggtcgtgaag
cgcatcaacaacacgttccagcgtgccgaccagatccagtggagcgaaggcaagggcgac
atcgactacttcgcaccgatcgtggctgacgcggaagccggttttggtggcgtgctgaat
gccttcgaactgatgaagtcgatgatcgacgcgggcgctgccggcgttcacttcgaagac
cagctcgcttcggtgaagaagtgcgggcacatgggtggcaaggtgctggtgccgacccgc
gaggctgtcgccaagctgaccgcagcgcgtctcgccgccgacgtctcgggcgtgccgacc
ctggtgatcgcccggaccgacgcggaagccgctgaccttgtgacttccgacgtggacgag
cgcgaccagccgtttctgaccggcgagcgtaccgtggagggtttcttccgttcgaagccc
ggcatcgagcagtcgatcgcccgtgccctggcctatgccgaggtggctgaccttgtgtgg
tgcgaaaccggcaagccggacctcgagttcgccaagcgcttcgcacaagccgtgcacgcg
aagttcccgggcaagctgttggcctacaactgctcgccatcgttcaactggaagaagaac
ctcgacgacgcaacgatcgccaagttccagaaggaactcggcgcgatgggctacaagttc
cagttcatcacgttggcgggcttccattcgctgaactactcgatgttcaacctggcccac
ggctacgcccgcaaccagatgtcggcattcgtggagttgcaggaagcggaattcgccgcc
gcggagaagggctttaccgctgtgaagcaccagcgcgaagtgggtacgggctacttcgac
gccgtgacgcagaccatcgaaggcggccagtcgtcgacgacggcgctcaagggatcgacc
gaagacgaacagttctttgaaaagaaggtggcctga

DBGET integrated database retrieval system