KEGG   Cupriavidus metallidurans: Rmet_1420Help
Entry
Rmet_1420         CDS       T00351                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00300  Lysine biosynthesis
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01230  Biosynthesis of amino acids
Module
rme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rmet_1420 (dapE)
Enzymes [BR:rme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rmet_1420 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF3224
Motif
Other DBs
NCBI-ProteinID: ABF08303
JGI: Rmet1420
UniProt: Q1LNH3
Position
complement(1534987..1536138)
Genome map
AA seq 383 aa AA seqDB search
MNPTLALTEDLIRRRSVTPADEGCQAVLETRLKALGFTCENIVSGPDDFRVTNLWAVKRG
TQGTAGKLLAFAGHTDVVPTGPLDQWSSDPFEPSHRDGKLYGRGAADMKTSIAGFVVAVE
EFVAKHPEHKGSIAFLITSDEEGPAHDGTVKVVEALKARGERLDYCVVGEPTSVDTLGDM
VKNGRRGSLSGKLTVKGVQGHIAYPHLARNPIHLAAPALTTLVNEVWDAGNEYFPPTTWQ
MSNIHGGTGATNVIPGHVTIDFNFRFSTASTPDGLKSRVHAILDQHGLDYTLDWTLGGEP
FLTPRGDLSEALGAAIAAETGVKTELSTTGGTSDGRFIAKICPQVIEFGPPNASIHKIDE
HVEVRFVEPLKNVYRGVLERLIA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgacccttgccctgaccgaagacctgatccgccgccgctcggtcacccccgcc
gacgaaggttgccaggccgtgctcgagacccgactcaaggcccttggctttacctgcgag
aacatcgtcagcggccctgacgatttccgcgtcaccaacctgtgggcggtcaagcgcggc
acccagggcacggcaggcaagctgctggcctttgccggccataccgacgtagtgccgacc
ggcccgctcgaccaatggtcatcggacccgttcgagccctcccatcgcgatggcaagctc
tacggtcggggcgcggccgacatgaagacgtcgattgccggcttcgtggtggcggtcgag
gagttcgtggcgaaacaccccgagcacaagggatcgatcgccttcctgatcacgagcgac
gaggaaggcccggcgcatgacggcaccgtgaaggtggtggaagcgctgaaggcacgcggc
gaacgtctcgactattgcgtggtgggcgagccgacctcggtcgacacgctcggcgacatg
gtcaagaacggccgtcgtggctcgctgtccggaaagctcacggtcaaaggtgtgcaaggc
cacatcgcctacccgcacctggcgcgcaacccgatccaccttgccgcgccggcactgacc
acgctggtgaacgaggtatgggacgcgggcaacgagtatttcccgcccaccacgtggcag
atgtcgaatatccatggcggcaccggcgcgaccaacgtgatcccgggccacgtgacgatc
gatttcaacttccgcttctcgacggccagcacgcctgacggcctgaagtcgcgcgtgcac
gcaatcctcgaccagcacgggctcgactacacgctcgactggacgctgggcggcgagccg
ttcctgacgccgcgcggcgacctgtccgaagcactgggcgcggccatcgcggccgagacc
ggcgtgaagacggaactctcgaccaccggcggcacctccgacggccgtttcatcgcgaag
atctgcccgcaggtcatcgaattcggcccgccgaacgccagcatccacaagatcgacgaa
cacgtggaagtccgcttcgtcgaaccgctcaagaacgtttaccgtggcgtgctggaacgc
ctgattgcctga

DBGET integrated database retrieval system