KEGG   Cupriavidus metallidurans: Rmet_1520Help
Entry
Rmet_1520         CDS       T00351                                 

Gene name
cbbJ1
Definition
triosephosphate isomerase (CbbJ) (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rme  Cupriavidus metallidurans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmet_1520 (cbbJ1)
   01230 Biosynthesis of amino acids
    Rmet_1520 (cbbJ1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_1520 (cbbJ1)
   00051 Fructose and mannose metabolism
    Rmet_1520 (cbbJ1)
   00562 Inositol phosphate metabolism
    Rmet_1520 (cbbJ1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rmet_1520 (cbbJ1)
Enzymes [BR:rme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rmet_1520 (cbbJ1)
Exosome [BR:rme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rmet_1520 (cbbJ1)
  Exosomal proteins of bladder cancer cells
   Rmet_1520 (cbbJ1)
  Exosomal proteins of melanoma cells
   Rmet_1520 (cbbJ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1642414..1643232
Genome map
AA seq 272 aa AA seqDB search
MDPTPLPPHPVRGQRRRLLVAGNWKMNGSLAGVQALAAAIADGAVARLDRVQLVLFPPFT
YLPEAQRRLGASGMAWGAQNVSGHEDGAFTGEVSAQMLREFGCACVLVGHSERRTLFGEN
DAVVARKFLAVRQAGMTPVLCVGESLPEREQGATEDVVARQLQAVLDLAGASAFADAVVA
YEPVWAIGTGKTATPAQAQDVHAFIRGRLAEADPAIAASLHVLYGGSMKRANARELLAMP
DIDGGLLGGASLNVDEFMAVAITAQRLAQENT
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggacccgacccccctcccgccgcacccagttcgcggccaacgccgacgactgctggtg
gccggcaactggaagatgaacggcagtctggccggcgtacaggcgctggcggcggcgatc
gccgacggtgccgtggcacgcctggaccgtgtgcaactggtactgttcccaccctttacc
tacctgcccgaggcgcagcgccgcctgggcgccagcggcatggcctggggcgcacagaac
gtctcggggcatgaagacggtgccttcaccggcgaagtatcggcccagatgttgcgggag
ttcggctgcgcctgtgtgctggtcggccactccgagcggcgcacgctgttcggcgagaac
gacgccgtcgtggcgcgcaagttccttgcggtccgccaagccggaatgacgccggtgctg
tgcgtcggcgagtcgctgccggagcgcgagcaaggtgcgaccgaggatgtggtggcgcgc
cagctccaggcggtgcttgatctggccggggcgagtgcgtttgccgatgcggtcgtggcc
tacgagcccgtgtgggcgatcggcacgggcaaaacggccacacccgcccaggcgcaggac
gttcacgccttcatccgtggccgactggccgaggcggacccggccatcgcagcgtcgctg
cacgtcctttacggcggcagcatgaagcgagcgaacgcacgcgagctgctcgccatgccc
gacatcgatggcggcctgttgggcggggcgtcgctgaacgtcgacgagttcatggccgtg
gccatcacggcccagcggctcgcgcaggagaacacttaa

DBGET integrated database retrieval system