KEGG   Cupriavidus metallidurans: Rmet_1854Help
Entry
Rmet_1854         CDS       T00351                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rme  Cupriavidus metallidurans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rme00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2008700..2009365)
Genome map
AA seq 221 aa AA seqDB search
MAYGAQDCLLVIDVQNDFMPGGALAVPRGDEVVPIINRLAPAFEHVVLTQDWHPAGHVSF
ATSHVGTAPFQTMMLPYGEQVLWPDHCVQGTPGAALHADLRIPHARMVIRKGHHANVDSY
SAFMEADRATKTGLAGYLREQGVRRVVCVGLATDYCVAWTALDARAAGFEAVVVEDACRA
IDLNGSLDRAWRELAAAGVRRTTADALRSGAGTHNPWLPES
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcctatggcgcgcaggattgcctgctggtgatcgatgtgcagaacgacttcatgccg
gggggcgcgctggccgtgccgcgcggcgatgaagtcgtgccgatcatcaaccggttggcg
ccggcattcgagcacgtggtgctgacgcaggactggcatcccgccggtcatgtgtccttc
gcaacgagccatgtcggtaccgcgccgttccagaccatgatgttgccgtatggcgagcaa
gtgctgtggcccgatcactgcgtgcagggcacgcccggcgccgcgctgcatgcagacctg
cgcatcccgcacgcgcggatggtgatccgcaagggtcaccacgccaacgtggacagctac
agcgcgttcatggaggcggaccgcgcgacgaagaccggactggctggctacctgcgcgag
cagggcgttcgccgggtggtctgcgtcgggttggcaacggattactgcgtggcctggacc
gcgctcgatgcgcgcgcagcgggcttcgaggcggtggtcgtggaagatgcctgccgcgcg
atcgatctgaacggatcgctcgaccgggcatggcgagaactggctgcggccggtgttcgt
cgtacgactgccgatgcactgcggtctggtgctggtacgcacaatccctggctccctgag
tcctga

DBGET integrated database retrieval system