KEGG   Cupriavidus metallidurans: Rmet_1865Help
Entry
Rmet_1865         CDS       T00351                                 

Gene name
msrB
Definition
methionine sulfoxide reductase B (EC:1.8.4.11)
Orthology
K07305  
peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
rme  Cupriavidus metallidurans
Brite
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     Rmet_1865 (msrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2023374..2023781
Genome map
AA seq 135 aa AA seqDB search
MTTTKTDAEWRSQLSDIEYRVTREAATERPFTGQYWDHWNQGIYHCVGCGTPLFESATKF
DAGCGWPSYFRPINGEVIAEHTDHSHGMTRVEVRCKECGSHLGHVFEDGPAPTGLRYCIN
SAALKFDDRDPEDRG
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccaagaccgacgccgaatggcgctcccagttgtccgacatcgagtaccgc
gtcacgcgcgaggccgccaccgagcgcccgttcaccggccagtactgggaccactggaac
cagggcatctaccattgtgtgggctgcggcacgccgctgttcgagtcggccaccaaattc
gacgccggctgcggctggccgagctatttccgcccgatcaacggcgaagtgatcgccgaa
cacaccgaccatagccatggcatgacacgggtggaagtccgctgcaaggaatgcggcagc
catctgggccacgtcttcgaggacggccccgctcccaccggacttcggtattgcatcaac
tcggctgcgctaaaattcgatgatcgcgatccggaagatcgtgggtga

DBGET integrated database retrieval system