KEGG   Cupriavidus metallidurans: Rmet_1881Help
Entry
Rmet_1881         CDS       T00351                                 

Definition
acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rme  Cupriavidus metallidurans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rmet_1881
Enzymes [BR:rme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rmet_1881
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rmet_1881
Lipid biosynthesis proteins [BR:rme01004]
 Fatty acid synthase
  Component type
   Rmet_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2043392..2044072
Genome map
AA seq 226 aa AA seqDB search
MDVDMRERMTNSRRRQWLAALGITLATAVMTAVPAHAQSGNKPALLVLGDSLSAEYGIAR
GTGWVSLLQDRLSKERFDYSVVNASISGETTIGGKTRLPDLLKRHKPAVVIVELGANDAL
RGFPLQTTEANLRTIVSDAQRAGATVLLVGMRIPPNYGQDYTERFFALYSKLAKEKRAAL
VPFLLDNVISRPEWFQTDRIHPTSAAQPTLLDNVWSQLKPLLKKAA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggacatgcgagagaggatgacaaacagtaggcgccggcaatggctggcggcg
ttgggtatcacactggcaactgccgtcatgacggcagtgccggcgcacgcgcaatctggc
aacaagcccgcgctgctggtactgggcgacagcctgtccgcggagtacggcattgcacgc
ggcactggctgggtcagcctgctgcaggaccgcctgagcaaggagcggttcgattatagc
gtcgtcaacgcgagcatcagtggcgagaccacaatcggtggcaaaactcgcctgcctgac
ctgctcaagcgacacaagccggcggtggtaatcgtcgagctgggtgccaacgacgccctg
cgcggcttcccgttgcagaccaccgaggccaatctgagaacgatcgtcagcgatgcccag
cgagctggtgccactgtgctgctcgtgggaatgcgaatcccgccgaactatggtcaggat
tacaccgagcgattcttcgcactctacagcaagctggccaaggaaaaacgggccgcgctg
gtgcccttcctgctggacaacgtgatctcgcgtcccgaatggttccagaccgatcggatt
catccgacctccgctgcacagcccacgttgctggacaatgtctggtcgcagttgaaaccg
ttgttgaaaaaggcggcgtag

DBGET integrated database retrieval system