KEGG   Cupriavidus metallidurans: Rmet_1965Help
Entry
Rmet_1965         CDS       T00351                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rme  Cupriavidus metallidurans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmet_1965 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmet_1965 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rmet_1965 (thrC)
Enzymes [BR:rme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rmet_1965 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2140320..2141765)
Genome map
AA seq 481 aa AA seqDB search
MNYQSTRGHDVPQSFSEILLGGLAPDGGLYLPKQYPQITAEELEAWRKLPYADLAFEVLS
RFCDDIPAEDLRALTRKTYTADVYCNARAGDNTADITPLRTLGEEGGTKLQLLGLSNGPT
LAFKDMAMQLLGNLFEYALKRAGLKLNILGATSGDTGSAAEYAMRGKEGIRVFMLSPHRK
MSAFQTAQMFSLQDPNIFNIAIEGVFDDAQDIVKAVSNDHAFKARQRIGTVNSINWARVV
AQVVYYFKGWLLATSGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGTYRVRTSAQTYHTSSPSMDISKASNFERFVFDLLGQDADKLVALFSDVDTKGGF
DLAGTPEFARIGQFGFVSGRSSHQDRLATIRDVNQRYGVTIDTHTADGVKVAREYLQPGV
PMVVLETALPAKFADTIHEALGHEPERPAAFDGIEKLPQRFEVMPADADSVKAYIAQHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccagtcgacgcgcggccatgacgtgccgcaatcgttctccgagatcctgctc
ggtggcctggcgcccgatggcggcttgtatctgcccaagcagtacccgcagatcacggcc
gaggaactcgaagcctggcgcaagctcccgtacgccgacctggcgttcgaggtgctgtcg
cgcttctgtgacgacatccccgccgaggacctgcgcgcgctgacgcgcaagacctacacg
gctgacgtgtactgcaacgcgcgagccggcgacaacactgccgacattacgccgttgcgt
acactgggcgaagagggcggcacgaagctgcaactgctgggcctgtccaacggcccgacg
ctggccttcaaggacatggcgatgcagttgctgggcaacctgttcgagtacgcgctcaag
cgcgcgggtctgaagctgaacatccttggcgcgacttccggcgataccggtagcgcggcc
gagtacgcgatgcgcggcaaggaaggcattcgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcccagatgttcagcctgcaggacccgaacatcttcaatatc
gcgatcgaaggtgtgttcgacgacgctcaggacatcgtcaaggccgtctcgaacgatcat
gcgttcaaggcgcgccagcgcattggcacggtcaactcgatcaactgggcccgcgtggtc
gcccaggtggtctactacttcaagggctggctgctggcgaccagcggtccgggacagaag
gtgtcgttctgcgtgccgtcgggcaacttcggcaacgtctgcgccggccacatcgcgcgc
atgatgggcctgccgatcgacaagctcgtggtggccaccaacgagaacgacgtgctggac
gagttcttccgcaccggcacgtatcgcgtgcggacctcggcccagacgtaccacacgtcg
agcccgagcatggacatctcgaaggcatcgaacttcgagcgtttcgtgttcgatctgctg
ggccaggacgccgacaagctggtggcgctgttcagcgacgtcgacaccaagggtggcttc
gatctggcgggcacgccggaattcgcgcgcatcggccagtttggctttgtttccggccgc
agctcgcaccaggaccgtctggcgacgatccgcgacgtgaaccagcgctatggcgtgacg
atcgacacccataccgccgatggcgtgaaggtggcgcgcgagtacctgcagccgggcgtg
ccgatggtggtgctggaaaccgcgctgccggccaagttcgccgacacaatccacgaggct
ttgggccatgagccggaacgtccggctgcgttcgacggtatcgagaagctgccgcaacgc
ttcgaggtgatgccggccgacgcggacagcgtgaaggcgtatatcgcccagcacaccggt
ttgtga

DBGET integrated database retrieval system