KEGG   Cupriavidus metallidurans: Rmet_2117Help
Entry
Rmet_2117         CDS       T00351                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rme  Cupriavidus metallidurans
Brite
Enzymes [BR:rme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rmet_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2298818..2299726)
Genome map
AA seq 302 aa AA seqDB search
MSSTPRRSRFPLPLDAVVERKPAPARTAGMPAVGKRAASPAPASTAVKPRKPAAPPVAPP
PPGSAVEARASAAVAGGGGMASDRARAALAARLRAGGIRDERVLGAIATVPRHLFMEPGL
ASQAYEDAALPIGHQQTISKPSVVARMIELLREGMPSDHALARVLEIGTGCGYQAAVLSL
VAQEVFSIERIRPLHEQAKANLRPLRVPNIRLHYGDGMLGLPQAAPFSSIILAAAGMEVP
QALLEQLAIGGRLIAPVVAPSSGAPGQTVTQQLLLIERLNRHRFHRTALEAVFFVPLKSG
TI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagttccacgccgcgccgatcccgctttccacttccgctcgatgcggtggttgagcgc
aagcccgcgccagcacgaaccgccggaatgcctgcggtcggcaagcgcgcggcatccccg
gcgccggcatcgacggccgtcaagccgcgcaagccggcggctccaccggttgcaccgccg
ccgccgggcagtgccgtggaagctcgggcgtccgcagcggtggctggcgggggtgggatg
gcatcggatcgggctcgggcggcattggcagcccgcctgcgcgccggcggcattcgcgac
gagcgggtgcttggcgccattgccacggtgccgcgccacctgttcatggagccgggcctg
gcttcccaggcgtacgaagacgccgcgttgccgattggacatcagcaaaccatttcgaag
ccgtccgtggtggcgcgcatgattgagttgctgcgcgaagggatgccatccgatcacgcg
ctggcgcgcgtgctggagatcggcaccggctgcggttatcaggcggccgtgctgagtctg
gtggcgcaggaagtgttctccatagagcggattcgtccgctgcacgaacaagccaaggcg
aacctgcggccgttacgcgtgccaaacatccggttgcattacggcgacgggatgcttggc
ctgccgcaggccgcgccgttttcgtcgatcatcctggccgccgctggcatggaggttccg
caggcgttgctggaacaactggccatcggcgggcggctgatcgccccggtggtcgcgccc
agctctggcgcgcccgggcagaccgtgacgcagcagttgctgctgatcgagcgcctcaac
cggcatcgttttcacagaactgcgcttgaagcggttttctttgtgcccttaaaatcgggc
accatctga

DBGET integrated database retrieval system