KEGG   Cupriavidus metallidurans: Rmet_2187Help
Entry
Rmet_2187         CDS       T00351                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00790  Folate biosynthesis
rme01100  Metabolic pathways
Module
rme_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rmet_2187 (folP)
Enzymes [BR:rme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rmet_2187 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF1685
Motif
Other DBs
NCBI-ProteinID: ABF09066
JGI: Rmet2187
UniProt: Q1LLB0
Position
complement(2395138..2396007)
Genome map
AA seq 289 aa AA seqDB search
MSTEFFQCGRYRFSRRRRPLVMGILNVTPDSFSDGGQHATRDAALRHAEQLIAEGVDIID
IGGESSRPGSAALPLDQELDRVMPIVESLADCGKPLSIDTYKPEVMRAALAGGADLINDI
WGFRMPGAVEAVAAGQFGLCVMHMQRDPQTMQEDPHYTDVVAEVASFLEERVSTLRAAGI
DTARISLDPGFGFGKTPDHNLRLLGQLPSLAVDGLPILVGLSRKSTLGAIIGGKPPQARV
AASVAAAVCAAERGAYIVRVHDVEQTVDALKVWWAVRQESVAPDGQHGE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgactgagttcttccagtgcgggcgctatcgtttttcccgccgccgccgcccactc
gtgatgggtattctcaatgtgacccctgattcgttctcagatggcgggcagcacgccacc
cgtgacgccgcgctgcgccatgcggagcaattgattgcggagggtgtcgacatcatcgat
atcggtggggagtccagccgacctgggtcggccgcgctgccgctcgatcaggaactagat
cgcgtgatgccgatcgtcgagtcgctggccgattgcggtaagccgctttcgatcgacacc
tacaagccggaggttatgcgtgcagcgctggcgggcggagcagatctgatcaatgatatc
tggggcttccgaatgccgggtgcggttgaggcagttgccgcagggcagttcggactatgc
gtcatgcatatgcagcgtgatccccagacgatgcaggaagatccgcactacaccgatgtg
gttgccgaggtggcatctttcctggaagaacgggtgtcaaccctgcgtgcggcgggcatc
gacacggcacgtatttcccttgatccaggttttggatttggcaagactccagatcataat
ctgaggttgctcggacaattacctagccttgctgttgatggcctgccgatcctggtgggt
ctgtcgcgcaaatcgacgctgggtgcaatcatcggcggcaaacctccacaggcgcgcgta
gctgccagtgtggcggcagccgtgtgcgcagctgagcgcggcgcatatatcgtccgggta
catgatgttgaacaaacagtggacgccctcaaggtgtggtgggccgtccgccaagaatca
gttgcccccgatgggcaacacggagaatga

DBGET integrated database retrieval system