KEGG   Cupriavidus metallidurans: Rmet_2238Help
Entry
Rmet_2238         CDS       T00351                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rme  Cupriavidus metallidurans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rme00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2453323..2454855
Genome map
AA seq 510 aa AA seqDB search
MTSTTSHQPQYVLALDQGTSSSRAILFDHLGNVVRIAQREFRQYYPHPGHVEHDPYEIWQ
SQLAVAHEVLGDAGVSGTQISAIGITNQRETTVLWDRKTGEPVGRALVWQDRRTAPMCED
LQAAGHAETFQRKTGLIVDAYFSGTKLRWMLDNYEGARARAERGELAFGTVDSWLIWQLT
DGARHVTDVSNASRTMLFNIHDFRWDDELLGLLDIPRNLLPEVVPSSGEVARASARLFGV
EIPIAGIAGDQQAATFGQACLRPGMAKNTYGTGCFILMNTGDKPVTSHNRLITTIGWQIG
GNTQYCLEGGVFMGGATIQWLRDGLKLIHSAPEVEPLARQCTDTGGVVLVPAFAGLGAPH
WDPFARGTLVGITRGTGGPHIARAALESIALQSVDVLDAMQKDAGISLAELRVDGGASRS
DLLMQMQADLLGTVVVRPRVTETTALGAAYLAGLATGYWTDPEEITRQWQVEQRFEPKLS
ADERERRIARWHRAVDRARDWARESDDAAR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacatccacgacatctcatcagccgcagtacgtgctggccctggatcagggcaccagc
agttcgcgcgccatcctgttcgatcacctgggcaatgtcgtacgcatcgcccagcgtgag
tttcggcaatattatccgcatcccggccacgtcgagcacgacccctatgagatctggcag
tcgcaactggccgtggcgcacgaggtactgggcgacgcgggcgtcagcggcacgcagatt
tctgccatcggcatcacgaaccagcgcgaaaccacggtgctgtgggatcgcaagaccggt
gaaccggtgggccgcgcgctggtctggcaagaccgccgcaccgcaccgatgtgcgaggac
ctgcaggcagcgggccacgcggagacatttcagcgcaagaccggactgatcgtcgacgcc
tatttctccggcaccaaactgcgctggatgctcgacaactacgagggcgcccgcgcacgc
gccgagcgcggcgagttggcctttggcaccgtcgatagctggctgatctggcagttgacc
gatggtgcgcggcacgtcaccgacgtttccaatgcttcgcgcacgatgctgttcaacatc
cacgatttccgctgggacgatgaactcctgggcctgctggatattccgcgcaacctgctg
ccggaagtggtgccgtcgagcggcgaggtcgcgcgcgcatcggcacggctgttcggcgtg
gagattccgattgccggcatcgccggcgaccagcaggccgccacgtttggccaagcttgc
ctgcggccgggcatggccaagaacacctatggcaccggctgcttcatcctgatgaacacc
ggcgacaaacccgtaacatcgcacaaccggctgatcacgaccatcggctggcagatcggc
ggcaatacccagtactgtctggaaggcggcgtattcatgggcggcgcgacgatccagtgg
ctgcgcgacggcctcaagctgatccacagcgcccccgaggtagagcctctggcccgccag
tgcaccgacaccggcggcgtggtgctggtgccggcattcgccggcctcggcgcgccgcac
tgggatccgttcgcacgcggcacgttggtcggcatcacgcgcggtaccggcgggccgcac
atcgcccgggccgcgctcgaatccatcgcgctgcagagcgtggatgtgctcgacgccatg
cagaaggacgccggcatctcgctggccgaactccgggtcgatggcggtgcctcgcgcagc
gacctgctgatgcagatgcaggccgacctgctcggcaccgtcgtggtccggccgcgcgtg
accgaaaccaccgcgctaggcgcggcatatctcgccgggctggcaactggttactggacc
gaccccgaagaaatcacgcggcagtggcaggtggagcagcgcttcgagccgaagctgtcc
gccgacgaacgcgaacgccgcattgcgcgttggcaccgcgccgtcgaccgcgcccgcgac
tgggcgcgcgagtccgatgacgccgcacgctga

DBGET integrated database retrieval system