KEGG   Cupriavidus metallidurans: Rmet_2251Help
Entry
Rmet_2251         CDS       T00351                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rme  Cupriavidus metallidurans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rme00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2467411..2468574
Genome map
AA seq 387 aa AA seqDB search
MRRAMAWLLRATVVCTLAGTVLTSAAATCAWPDWDAFRRSTISQDGRVIDDSTDQQVTVS
EGQSYALFFALVANDRATFDKLLTWTENNLAQGDLTAHLPAWIWGKRTEGEHAGTWGVID
ANPASDADLWIAYSLLEAGRLWNERRFTALGTLLARRALREETAVLPGLGRTLLPGPTGF
HTSPDVWRLNPSYVPLQVMRRLAAMPGEDSSWKTLVDTSARLILNTAPHGFSPDWVEYHK
GRGFRPDTQTQAGGSYNAIRVYLWAGMMAPRDPLRTSVLQAFRPMADYVRKQGDPPERVD
TQSGTFGPNSGNGGFSAAVAPYLAALGQTDDARAQAQRARDLAAQKPAGYYSQVLALFGL
GHLDGHFRFEADGTLVPAWKSTCPATR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgggcaatggcctggctgttgcgggctaccgtcgtatgcacgctggccggcacg
gtgttgaccagtgccgcggccacctgcgcgtggcccgactgggatgccttccggcgcagc
acaatcagccaggacggccgcgtgatcgacgacagcaccgaccagcaggtgacggtctcc
gaaggccagtcgtatgcgcttttcttcgcgctcgtggccaacgaccgcgccaccttcgac
aagctgctgacctggaccgagaacaacctcgcgcaaggcgacctgacggcccatctgccc
gcgtggatctggggcaagcgcaccgaaggcgagcacgcaggcacctggggtgtcatcgac
gccaatccggcatcggacgcggacctgtggatcgcctactccctgctcgaagccggccgc
ctctggaacgagcgccgcttcacggcgcttggaacgctgttggcgcgccgcgccctgcgc
gaggaaacggcggtgctgcccggactcggccgcacgttgctgcccgggcccactggattc
cacacgtcgcccgatgtctggcgcctgaatccgagttatgtgccattgcaggtcatgcgg
cggctggcagccatgccgggcgaggacagcagctggaaaacgctagtcgacacctcggcc
cggctgatcctgaacacggcgccgcacggcttttcgcctgactgggtggagtatcacaag
ggtcgaggcttccggcctgatacgcagacacaggccggcggctcatataacgcgatccgg
gtgtatctctgggccggcatgatggcgccacgcgatccgctgcgcacttcggtgctccag
gcgttccgcccgatggccgattacgtccgcaagcaaggggatccgcccgagcgggtcgat
acccagtcgggcacgttcggaccgaacagcggcaacggtggcttctcggcagccgtcgcg
ccctaccttgccgccctgggacagaccgatgatgcgcgcgcgcaggcgcagcgcgcccgc
gacctggccgcgcagaagcccgccggctactacagccaggtgctggcgctgttcggcctg
ggccatcttgacggacatttccgcttcgaagcggacggcactctggtgccggcctggaaa
tccacatgccccgccacgcgctag

DBGET integrated database retrieval system