KEGG   Cupriavidus metallidurans: Rmet_2465Help
Entry
Rmet_2465         CDS       T00351                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rme  Cupriavidus metallidurans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmet_2465 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmet_2465 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmet_2465 (trpA)
Enzymes [BR:rme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rmet_2465 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2676407..2677204)
Genome map
AA seq 265 aa AA seqDB search
MSRIQKTFAALAAQQKKGLIPFITAGDPAPALTVDLMHALVAGGADVIELGVPFSDPMAD
GPVIQRASERALAQGVSLTQVLAWVTEFRKTNATTPVVLMGYANPIERMGEETFAKAASA
AGVDGVLVVDYPPEECESFAALMRANQMDPIFLLAPTSTDDRIAAVAKVASGYLYYVSLT
GVTGSATLDLESVAARLPLIKQHANLPVGVGFGIRDAQTARAIGSVADAVVIGSRLVQLL
EDAPREKAVDSLRAFIADIRQALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatccagaagactttcgcggcactggccgcgcagcagaagaagggcctgatt
ccgttcatcaccgccggcgatccggctcccgcgttgaccgtcgacctgatgcacgccctc
gtggctggcggcgccgacgtgatcgagcttggcgtgccgttttcggacccgatggccgac
ggccccgtgattcagcgcgcctccgagcgcgcgctggcccagggcgtttcgctgacgcag
gtgctggcctgggtgaccgagttccgcaagacgaacgcgaccacgccggtagtgctgatg
ggctacgccaacccgatcgagcgcatgggtgaggaaaccttcgccaaggcggccagcgcg
gccggcgtggacggcgtgctcgtggtcgactacccgcccgaagagtgcgagtctttcgcc
gcgctgatgcgcgcgaaccagatggacccgatcttcctgctggcgccgacctcgaccgac
gaccgtatcgccgcggtggcgaaggtggccagtggctatctgtactacgtgtcgctcacg
ggcgtgaccggctcggccacgctcgacctcgagagcgtggctgcgcgtctgccgctgatc
aagcagcacgcgaacctgcccgtgggcgtgggtttcggtatccgtgatgcgcaaaccgca
cgtgccatcggcagcgtggccgacgccgtggtgattggcagccgcctggtgcagttgctt
gaggatgcgccgcgcgagaaggccgtggactccctgcgtgcctttatcgccgacatccgc
caggcactggacgcctga

DBGET integrated database retrieval system