KEGG   Cupriavidus metallidurans: Rmet_2467Help
Entry
Rmet_2467         CDS       T00351                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00260  Glycine, serine and threonine metabolism
rme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01130  Biosynthesis of antibiotics
rme01230  Biosynthesis of amino acids
Module
rme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmet_2467 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmet_2467 (trpB)
Enzymes [BR:rme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rmet_2467 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABF09344
JGI: Rmet2467
UniProt: Q1LKI2
Position
complement(2678151..2679374)
Genome map
AA seq 407 aa AA seqDB search
MADALPESLDMYDLPDSRGHFGPYGGTFVSETLVHALDELRDAYARYQKDPDFDAEYRRE
LKHFVGRPSPIYHAQRWSETLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVI
AETGAGQHGVATATIAARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLK
DALNEAMRDWVTNVETTFYIIGTVAGPHPYPMMVRDFQCVIGEEAKVQMPELAGRQPDAV
IACVGGGSNAMGIFYPYIEHKDVQLIGVEAAGDGLDSGRHAAALIGGSPGVLHGNRTYLL
QDANGQIIETHSVSAGLDYPGVGPEHAWLKDMGRAQYVPITDEEALKAFHDCCRIEGIIP
ALESSHAIAYACKLAPTLGRDKLLLVNLSGRGDKDMHTVAERAGLKL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcgcttcctgagagcctggacatgtacgacctgcccgattcccgtggccac
tttggcccctatggcggtaccttcgtttccgaaaccctggttcacgcgctggacgagttg
cgcgacgcctacgcgcgataccagaaggaccctgatttcgacgccgagtatcgccgcgaa
ctgaagcacttcgttggccgcccgtcgccgatctatcacgcgcaacgctggagcgagacg
ctcggtggcgcgcagatctacctcaagcgcgaagacctgaaccacactggcgcgcacaag
atcaacaacgtgatcggccaggcgctgcttgccaagcgcatgggcaagaagcgtgtgatt
gccgaaaccggcgcgggccagcatggcgtggccacggccacgatcgcggcgcgctttggc
atggagtgcgtggtctacatgggctccgaggacgtgcgccgccaggcggccaatgtctat
cgcatgaagctgctgggcgccaccgtggtgcctgtggaaagcggctcgcgcacgctcaag
gacgcgctcaatgaagcgatgcgcgactgggtgaccaacgtcgagaccacgttctacatc
atcggcaccgtggccggcccgcacccctacccgatgatggtgcgcgatttccagtgcgtg
atcggcgaggaagccaaggtgcagatgcccgaactcgcgggtcgccagcccgacgccgtg
atcgcgtgcgtcggcggcggttcgaacgcgatgggcatcttctatccgtatatcgaacac
aaggatgtgcagttgatcggcgtggaagcggccggtgatggcctggattcgggtcgccac
gctgctgcgctgatcggcggttccccgggcgtgctgcacggcaaccgtacctatctgctg
caggacgccaacggccagatcatcgagacgcactcggtgtcggcaggcctggactacccc
ggcgtcggccccgagcacgcgtggctgaaggacatgggccgcgcgcagtacgtgccgatc
accgacgaagaggccctcaaggcgtttcacgactgctgccgcatcgaaggcatcatccca
gcgctcgaatcgagccatgcgatcgcctatgcgtgcaagctggcgccgacgctgggccgc
gacaagctgctgctcgtgaacctgtccgggcgtggcgacaaggacatgcataccgtggcc
gaacgcgcggggttgaagctctga

DBGET integrated database retrieval system