KEGG   Cupriavidus metallidurans: Rmet_2631Help
Entry
Rmet_2631         CDS       T00351                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rme  Cupriavidus metallidurans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rmet_2631 (galU)
   00052 Galactose metabolism
    Rmet_2631 (galU)
   00500 Starch and sucrose metabolism
    Rmet_2631 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Rmet_2631 (galU)
Enzymes [BR:rme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rmet_2631 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2867634..2868533
Genome map
AA seq 299 aa AA seqDB search
MENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGR
SKRAIEDHFDKAYELEAELEAKNKQALLDVVRSIKPANVECYYVRQPEALGLGHAVLCAA
KLVGDTPFAVMLADDLLDGGKDLPVMKQMVDIYNHYNCSVLGVEEIAPEQSRSYGVIDGR
EWDDRVIKMSAIVEKPAPEKAPSNLGVVGRYILTPRIFDHIRELKPGAGGEIQLTDAIQS
MLDQEQVLAYRYKGVRYDCGSKLGYLKATVEFALRHPEVRDEFSAYLSQRCTSPSSVPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccgcgtcaccaaggccgtctttcccgttgcagggctaggcacccggtttctg
cccgccaccaaggcgagccccaaggaaatgctgcccgtggtcgacaagccactgatccag
tacgccgtggaagaagccatggccgcaggcattaccgagatgatcttcgtcaccgggcgc
tccaagcgcgccatcgaggatcacttcgacaaggcttacgaactggaagcggaactcgag
gccaagaacaaacaggcactgctcgatgtggtgcgttcgatcaagccagcgaacgtcgag
tgctattacgtgcgccagcccgaggcactgggtctgggccacgcggtgctttgcgccgcc
aagctcgtgggcgacacgccgtttgccgtgatgctcgccgacgacttgctcgacggtggc
aaggacctgcccgtgatgaagcagatggtggatatctacaaccactacaactgctcggta
ctcggcgtggaagagatcgcgcccgagcaaagccgctcgtatggcgtgatcgacggccgc
gagtgggacgaccgcgtgatcaagatgtccgccatcgtcgagaagccggcacccgagaag
gcaccgtcgaacctgggcgtggtgggtcgctacattctcaccccgcgcatcttcgaccat
atccgcgagcttaagccgggcgccggcggcgagatccagctcaccgacgccatccagtcg
atgctcgaccaggaacaggtgctggcctatcgctacaaaggcgtgcggtacgactgcggc
agcaagctcggctatctgaaggcgaccgtcgaattcgccctcaggcaccccgaggtgcgc
gacgagttcagcgcctatctgtcgcagcgctgcaccagcccgtcaagcgtacccgcctga

DBGET integrated database retrieval system