KEGG   Cupriavidus metallidurans: Rmet_2716Help
Entry
Rmet_2716         CDS       T00351                                 

Gene name
cpsG
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00010  Glycolysis / Gluconeogenesis
rme00030  Pentose phosphate pathway
rme00051  Fructose and mannose metabolism
rme00052  Galactose metabolism
rme00230  Purine metabolism
rme00500  Starch and sucrose metabolism
rme00520  Amino sugar and nucleotide sugar metabolism
rme00521  Streptomycin biosynthesis
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_2716 (cpsG)
   00030 Pentose phosphate pathway
    Rmet_2716 (cpsG)
   00051 Fructose and mannose metabolism
    Rmet_2716 (cpsG)
   00052 Galactose metabolism
    Rmet_2716 (cpsG)
   00500 Starch and sucrose metabolism
    Rmet_2716 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    Rmet_2716 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    Rmet_2716 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rmet_2716 (cpsG)
Enzymes [BR:rme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rmet_2716 (cpsG)
    5.4.2.8  phosphomannomutase
     Rmet_2716 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABF09589
JGI: Rmet2716
UniProt: Q1LJT7
Position
complement(2949236..2950621)
Genome map
AA seq 461 aa AA seqDB search
MQIEPSIFKAYDIRGIVGKTLTPEVARLIGLSFGSAAAEQGERAVVVGRDGRLSGPDLLG
GLVEGLRAAGLDVIDLGMVATPMVYFGTNIELDGRRATSGIMVTGSHNPPDYNGFKMVLG
GKAIYGEQIQALRQRIEAGNFAKGNGGYKLVDVRQQYLDRIVGDVKLARPMKIALDAGNG
VAGAFVGDLFRALGCEVTELFCDVDGHFPNHHPDPAHVENLQDLIQCLRDTDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAEEILSRNPGAQVIYDVKCTGKLAPWIRQHGGEPL
MWKTGHSLVKAKLKETGAPIAGEMSGHVFFKDRWYGFDDGLYTGARLLEILSRHADASAV
LNALPNSNCTPELQLKCAEGEAFTLLDKIRANAKFDGAKEVITIDGVRVEYPDGFGLARP
SNTTPVVVMRFEADNDAALARIQAEFKRVILAEKPDAKLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgaaccttcgatcttcaaggcctacgacatccgtggcatcgtcggcaagacg
ctgacccccgaagtggcccgcctcatcggcctctcttttggctccgccgccgccgagcag
ggcgagcgggcggtggtggtcggccgtgacggccgcctgtccgggcccgatctgctggga
gggctcgtcgaaggccttcgcgccgccgggctcgacgtgatcgatctgggcatggttgcc
acaccgatggtctacttcggcaccaatatcgagctggacggccgccgcgccacgtccggc
atcatggtcacgggcagccacaacccgcccgactacaacggtttcaagatggtgctcggc
ggcaaggcgatctacggtgagcagatccaggcgctgcgccaacgcatcgaggcgggcaac
ttcgccaagggtaacggcggctacaagctcgtcgatgtgcgccagcaatacctggatcgc
atcgtcggcgatgtgaagctggcgcgccccatgaagatcgcgctcgatgccggcaacggc
gtggccggcgcgttcgtgggcgacctgttccgcgcgctcggttgcgaagtgaccgaactg
ttctgcgatgtcgacggccatttcccgaaccaccatcccgatcccgcccacgtggagaac
ctgcaggacctgatccagtgcctgcgcgatacggattgcgagctgggtctggcattcgat
ggtgacggcgaccgcctgggggtggtcaccaaggacgggcaggtcatcttcccggaccgg
caactgatgctattcgcggaggagatcctctcgcgcaatcccggcgcgcaggtgatctac
gacgtcaaatgcacgggcaagctggcaccgtggatccgccagcacggcggcgaaccgctg
atgtggaagacgggccattcgctggtcaaggccaaactcaaggaaacgggcgcgccgatc
gccggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttcgacgatggc
ctgtacacgggcgcgcggctgctcgagatcctgtcgcgccacgccgacgccagcgccgtg
ctcaacgcactgccgaactcgaattgcacacccgagctgcagctcaagtgcgccgagggc
gaggcgttcacgctgctcgacaagatccgcgccaatgcgaagttcgacggcgcgaaggaa
gtcatcacgatcgacggcgttcgcgtcgagtatccggacggctttggcctggcgcgtccg
tccaacaccacgccggtggtggtgatgcgtttcgaggccgacaacgatgccgcgctggcc
cgtatccaggccgaattcaagcgtgtgattctggctgagaaaccggatgcgaagctcccg
ttctga

DBGET integrated database retrieval system