KEGG   Cupriavidus metallidurans: Rmet_2732Help
Entry
Rmet_2732         CDS       T00351                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-deoxyrhamnose-3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00521  Streptomycin biosynthesis
rme00523  Polyketide sugar unit biosynthesis
rme01130  Biosynthesis of antibiotics
Module
rme_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rmet_2732 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rmet_2732 (rfbC)
Enzymes [BR:rme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rmet_2732 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABF09605
JGI: Rmet2732
UniProt: Q1LJS1
Position
complement(2968060..2968614)
Genome map
AA seq 184 aa AA seqDB search
MSLTVTRTAIPDVMIIEPKVFGDARGFFFESFNQKAFGEATGLDLEFVQDNHSRSAKGVL
RGLHYQIQQPQGKLVRVVRGRVFDVAVDIRKQSATFGKWVGVELSEDNHRQFWVPPGFAH
GFVVLSESADFLYKTTDYYAPQFERTIAWNDPEIGIEWPQMNVVPLLSAKDQAGVSLSSA
ELFE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaccgttactcgtaccgccattccggacgtgatgatcatcgagccgaaggtg
ttcggtgatgcccgggggtttttctttgagagcttcaatcagaaggcgtttggggaagct
actggcctggatctggagttcgtgcaagacaaccacagccgcagcgccaagggcgtactg
cgtggcctgcactatcaaatccagcagccgcaaggcaagctcgtgcgggtagtgcgtgga
cgggtgttcgacgtggcggtggatattcgaaagcagtccgcgacctttggtaaatgggtt
ggcgtggagctcagcgaagataatcatcgccaattctgggtgccgcccgggtttgcacat
ggattcgtggtgttgtcggaatctgctgatttcctttataagacaactgattattacgct
ccgcagttcgagcggaccattgcatggaacgatccggaaatcggcattgaatggccgcaa
atgaatgtcgtccctctgttgtccgccaaagatcaggcaggcgtgagtctttcctcggct
gaactgttcgagtga

DBGET integrated database retrieval system