KEGG   Cupriavidus metallidurans: Rmet_2748Help
Entry
Rmet_2748         CDS       T00351                                 

Gene name
hemDX
Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rme  Cupriavidus metallidurans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rmet_2748 (hemDX)
Enzymes [BR:rme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Rmet_2748 (hemDX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rmet_2748 (hemDX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2983756..2985837)
Genome map
AA seq 693 aa AA seqDB search
MPRPTVVVTRPAGQSRQLTEALQAAGLDVLSFPLLAIGPAADDVPLRAELGRIEDYALVV
FVSPNAVSYGLDTLAQVQNAPGGARWPESVPVAVVGPSSVVALAERGITPPAYRVIAPAG
AQGNDTAGDAARFDSEALWSELDTSPGAFAGRKVLIIRGSGGREWLADRLRDAGASVEAV
EAYSRTLPEPSGMQWQAVRDSLKPDAPPYAWLLTSSEAVRNLDGLARLHLSPQEHERLKQ
MQCIAPHARIAAQAQSLGFAHVLPAAPGDAGLLAACTQWGEAYAGPATPAPAPVSPAPAP
VVVQPEPEPTPAPMAPKEPTSTKVERVTTDTTSPSPNPGGNPGSSGMSGAFVTPARRMNP
WWLLVAVLVVAVAGGFWWLQMRVEHLTQELARRQQSADTLVQETRVLSRDAQETVKALQG
KVGALDGQITETRDKQAALEQVYQDLMRNRDDWEIAEIQQLLTNAGQQLQLTGNVQVALA
ALQSADARLARSDKPQYNQLRRAIARDIGRMKAVPDTDLTGAAIKLDEAINQIDSLPLLS
GERMLDRTPGEGNKPAPAAPKGASTPAAASATGGNMVSRLWTYVLDELGQVIRVRKVDDT
NALLLSGDQGWFLRENIKLRLLNARLALLSRNEPVFRNDLAAAQGMIARYCDTRSRRVQG
VLTMLKQAQASAVTVSLPTMAESLGALHALKKE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcccgaccgtcgtagtaacacgacccgccgggcagtcccggcaactgaccgaa
gcgttacaggccgcgggtctcgacgtgctcagttttccgctgctggcgatcgggcccgcg
gccgatgacgtgccgctgcgcgccgagcttggccggatcgaggactacgcgctggtggtg
ttcgtgagcccgaacgcggtgtcctatggactggacacccttgctcaggtccagaacgcc
ccgggcggagcccggtggccggaaagcgtgccggtggccgtggtggggccatcgagcgtg
gttgcgctggcggaacggggtatcaccccgcccgcgtatcgcgtgatcgcgcctgctggc
gcgcagggtaatgacacggccggcgacgcagcgcgcttcgattcagaggcgctctggtcc
gaactcgacacctcgccgggcgcgtttgccggccgcaaggtcctgatcatccgtggcagc
ggcgggcgcgaatggctggccgatcgtctgcgcgacgccggcgcgtccgtcgaagccgtg
gaagcctacagccgcacgctgcccgagccgagcggcatgcaatggcaggccgtgcgcgac
agcctcaagcccgatgcgccgccgtacgcgtggctgctgaccagttcggaagccgtgcgc
aacctggacgggctggcgcgtttgcatctgtcgcctcaggaacacgaacgtctgaagcag
atgcagtgcatcgcaccacatgcgagaattgccgcgcaggcccagtcgctgggatttgcc
cacgtgctgcccgccgcgcccggagatgccgggctgctggccgcatgcacgcaatggggc
gaagcctatgctgggccggccacgccagcgcccgcccccgtatcgcctgcacccgctccg
gtggtcgtgcagccggaaccggagccgacaccggcgccaatggcacccaaggaacccacg
tcaaccaaagtcgaacgcgtgacgacagacaccacgtccccctcgccgaatccgggcggt
aaccccggtagttccggcatgtccggcgcatttgtgacacccgcgcgccgaatgaatcca
tggtggctgctcgtcgccgtgctggtggtcgccgttgccgggggcttctggtggttgcag
atgcgggtcgagcatctgacccaggaactggcgcgccgccagcagagcgcggacacgctg
gtgcaggaaacgcgggtgctgtcgcgcgatgcgcaggagacggtcaaggcgttgcagggc
aaggtgggcgcactcgacggccaaatcacggagacgcgcgacaagcaggccgcgctggaa
caggtctatcaggacctgatgcgcaaccgcgacgactgggaaatcgccgaaatccagcag
ttgctgaccaacgccggccagcagcttcagctcaccggcaacgtgcaggtggcgctggcc
gcgctgcaaagcgccgacgcgcgcctggcgcgctcggacaagccgcaatacaaccagctt
cgccgcgctattgcgcgcgatatcggtcggatgaaggccgtgccggataccgacctgacc
ggggcggcgatcaagcttgacgaggcgatcaaccagatcgattcattgccgctgctgtcg
ggcgagcggatgctcgaccgcacgcctggcgagggcaacaagccggcaccggccgcgccg
aagggcgcctcgacgcccgcggctgccagcgcgacgggtggcaatatggtgtcgcgactg
tggacgtacgtgcttgacgagcttggtcaggtgatccgcgtgcgcaaggtcgatgacacc
aacgcgctactgctctcgggtgaccagggctggttcctgcgcgagaacatcaagctgcgc
ctgctcaatgcgcggctggcgctactgtcgcgcaacgaaccggtcttccggaacgacctc
gccgccgcgcagggcatgatcgcgcgctattgcgatacccgttcgcgccgcgtgcagggc
gtgctgacgatgctcaagcaggcccaggccagcgcggtgacggtatccctgccgacgatg
gcggagagcctcggcgcgttgcatgccctgaagaaggagtag

DBGET integrated database retrieval system