KEGG   Cupriavidus metallidurans: Rmet_2797Help
Entry
Rmet_2797         CDS       T00351                                 

Gene name
matA
Definition
Malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rme  Cupriavidus metallidurans
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rmet_2797 (matA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rmet_2797 (matA)
Enzymes [BR:rme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Rmet_2797 (matA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3044057..3045478)
Genome map
AA seq 473 aa AA seqDB search
MTALDTSDQQKVSAPLDAAEPVSDTLLSRFGRWWNRKGDADATAAGPAKAQDTPALSTRA
TKRQRDQLRQCFDARLTDVAANAAAQAWQDEYEAAVEPLRQAMLGVLAEVAAVRDAAGGQ
PATASGLSQALSNARIRFFKRFAALHGQRGNSACGLHFLIQLRADMLRWHKRIPGLRELD
EDLEALFSNWFDVGLLELQPITWDSPASLLEKLIRYEAVHEISSWTDLRNRLDSDRRCYA
FFHPRIPREPLIFVEVAFVPEMAANVQALLDEAAPLEDLRRVKWAIFYSISNTQAGLRGV
SFGNFLLKRVIEELQREHPKLKQFATLSPIPGFADWLRKRDGESIDRVLGVKRLARWREQ
HGEVPADGAAWFSALSADTEDTVIRDTAMTLAAHYLVREGGKGVPADPVARFHLGNGACV
ERVNWGADMSRKGRAQSCGMMVNYLYVPDALDDNLARLGDGNPRISRAVAKLL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctcgacacctcagatcaacagaaagtcagcgcgccgctcgatgccgccgag
cccgtgtccgacaccttgttatcgcgcttcggccgctggtggaaccggaagggcgatgcg
gatgccactgcggcaggccctgcgaaggcgcaggacacgcccgccctgtccacgcgcgca
accaaacgtcagcgcgaccagttgcgtcagtgcttcgacgcgcggctgaccgatgtcgcc
gccaacgccgccgcccaggcgtggcaggacgaatacgaggctgcggtggagccgcttcgc
caggcgatgctcggcgtgctggccgaggtggccgccgtccgcgatgcggctggcggccag
ccggctaccgcgtccggcttgtcgcaggcgctgtccaacgcacgcatccgttttttcaag
cgttttgccgcactgcatgggcagcgtggcaacagtgcttgcgggctgcacttcctgatc
cagttgcgcgcggacatgctgcgctggcacaagcgcatcccgggcttgcgcgaactcgat
gaggacctggaggcgctgttctcgaactggttcgacgtgggcttgctcgaactgcagccg
atcacgtgggactcgcccgcgtcgctgctcgagaagctgattcgctacgaggccgtgcac
gagatctcgtcatggaccgacctgcgcaaccggctggattcggatcgccgctgctatgcg
ttcttccacccccgcattccgcgcgaaccgctgatcttcgtcgaggttgcgttcgtgccc
gagatggccgccaacgtgcaggcactgctcgatgaagccgcaccgctggaagacctgcgg
cgcgtgaagtgggccatcttctattcgatctcgaacacgcaggcggggttgcgcggcgtg
agcttcggcaatttcctgctcaagcgggtgatcgaggaattgcagcgcgagcatcccaag
ctcaagcagttcgccacgttgtcgccgatccccgggtttgcggactggctgcgcaagcgg
gacggtgagtccatcgaccgcgtgctcggtgtcaagcgccttgcacgctggcgcgagcag
catggtgaggtgcccgccgatggcgcggcatggttcagcgcgttgtcagcggacactgaa
gataccgtgatacgcgatacagccatgacactggccgcgcactatctggtgcgagagggt
ggcaagggcgtgcccgccgatccggtggcgcgctttcacctcggcaacggcgcatgtgtg
gagcgcgtgaactggggcgccgacatgtcgcgcaaagggcgtgcgcaatcgtgcggcatg
atggtcaattacctttacgtgcctgatgcgctggatgacaatctggctcgccttggcgac
ggcaatccccgcatcagtcgggcggtggcaaagcttctgtaa

DBGET integrated database retrieval system