KEGG   Cupriavidus metallidurans: Rmet_2875Help
Entry
Rmet_2875         CDS       T00351                                 

Gene name
scd
Definition
Fatty-acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rme  Cupriavidus metallidurans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rme01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rme01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3125116..3126354)
Genome map
AA seq 412 aa AA seqDB search
MVVPHCIPRFLDGEHSLFDSILDWAANGLANWSWWEIVIYTLVMTHITIAGVTIFLHRCM
AHRSLDLHPIAQHFFRFWLWMTTGMVTKEWTAIHRKHHAKCETEDDPHSPQTRGIRKVLL
EGAELYRAEAKNKETITKFGHGTPDDWIERNLYSRFSWQGVALMLIIDLALFGLVGMSVW
AVQMLWIPIHAAGIINGLGHYWGYRNYDCEDASTNVSPWGFIIGGEELHNNHHTYPTSAK
FSIKWYEIDVGWWYIRAMQSVGLAKVKKIPPKARLVEARPVDHNTLEAIIANRYDVMARY
AKTLKSAYKDELRKHKEGNTPEYSSFKPARKWFHREETKLAAPQRQQLATIVEQNKMLST
FVEMRRELAVIWGRSNLTREQLLAQLQAWCHRAEASGIQALQEFSLRLRRYA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgccgcactgcatccctcgttttttagacggagaacacagtttgttcgactca
attcttgattgggccgccaacggcctcgccaactggtcctggtgggagatcgtgatctac
acgctcgtgatgacgcacatcacgatcgccggcgtgactattttcctgcaccgctgcatg
gcgcaccggtcgctggacctgcatccgatcgcccagcatttcttccgtttctggctgtgg
atgaccacgggcatggtgaccaaggagtggaccgcgattcaccgcaagcaccacgccaag
tgcgaaaccgaagacgatccgcacagcccgcagacccgcggcatccgcaaggtgctgctg
gaaggcgccgagctgtatcgcgccgaggccaagaataaggaaaccatcaccaagttcggc
cacggcacgcccgatgactggatcgagcgcaatttgtactcgcgcttctcctggcaaggc
gtagcgctgatgctgatcatcgacctggccctgttcggcctggtcggcatgtccgtgtgg
gcagtgcagatgctctggatcccgatccatgccgccggcatcatcaacggcctgggccac
tactggggctatcgcaactacgactgcgaggacgcatcgaccaacgtgtcgccgtggggc
ttcatcatcggcggtgaagagctgcacaacaaccaccacacgtacccgacgtcggccaag
ttctcgatcaagtggtatgagatcgacgtgggttggtggtacatccgcgcgatgcagtcg
gtgggcctggccaaggtcaagaagatcccgcccaaggctcgcctggtggaggctcgtccg
gtggatcacaacacgctggaagcgatcatcgctaaccgctacgacgtgatggcccgctat
gccaagacgctgaagtccgcctacaaggatgaactgcgcaagcacaaggaaggcaatacg
cccgagtactcgagcttcaagccggcccgcaagtggttccaccgcgaggaaaccaagctg
gctgcgccgcaacgtcagcaattggcgaccatcgtcgagcaaaacaagatgctgagcacg
ttcgtggaaatgcgccgcgaactggctgtgatctggggtcgctcgaacctgacgcgcgag
caactgctggctcagctgcaggcctggtgccatcgcgccgaagccagcggcatccaggcg
ctgcaggagttttcgctgcgcctgcgccggtacgcctga

DBGET integrated database retrieval system