KEGG   Cupriavidus metallidurans: Rmet_2915Help
Entry
Rmet_2915         CDS       T00351                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rme  Cupriavidus metallidurans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rmet_2915 (folK)
Enzymes [BR:rme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rmet_2915 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3169721..3170242
Genome map
AA seq 173 aa AA seqDB search
MTLAFIGIGANLGDARQAVKDAIVCLAQQVGITVVAKSSFYRTAPVDATGADYFNAVVKI
ETPFTAAQLLRICHHIEDQFGRERPFRNAPRTLDLDLLLFGAESINTEALTVPHPRITER
AFVLVPLVELDPAIEIPGVGPAAGFLPDVQEQRIEKFSSCKCSRMKEGDGARP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgccttcatcggcatcggcgccaatcttggtgatgcacgccaggcagtaaaa
gacgccatcgtgtgcctggcccagcaggtcggcattacggtggtcgccaagtcgtcgttc
tatcgcaccgcaccagtcgacgccacgggcgcggactacttcaatgcggtggtgaagatc
gagacgccgttcacggcagcgcagctcctgcgtatctgccaccacatcgaagaccagttc
ggccgggaacggccgttccggaacgcaccgcgcacgctcgacctggatctgctgctgttc
ggcgcggagtcgatcaataccgaagcgctgaccgttccgcatccgcgcatcaccgagcgt
gcgttcgtgctggtgccgctggtcgagctcgatcccgcgatcgagattcccggagttggc
cccgcggccggtttcctgccggacgtgcaagaacagcgcatcgagaagttttcctcatgc
aaatgctcgcgcatgaaggaaggcgacggcgcgcggccatga

DBGET integrated database retrieval system