KEGG   Cupriavidus metallidurans: Rmet_2986Help
Entry
Rmet_2986         CDS       T00351                                 

Definition
Guanyl-specific exported ribonuclease
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rme  Cupriavidus metallidurans
Brite
Enzymes [BR:rme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Rmet_2986
Transfer RNA biogenesis [BR:rme03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Rmet_2986
 Prokaryotic Type
    Rmet_2986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3244433..3244876)
Genome map
AA seq 147 aa AA seqDB search
MSSQSQRQSHWQSLSLARSLGHVLAGAAISIALTLAPQGAMARQSPDDVQGVVGTIAAQQ
LPNEARQTLERIEAGGPFPYDKDGSRFGNYERSLPQQSRGYYREYTVKNSNSRNRGAKRI
VCGGDQRAANDCYYTEDHYNSFKRITK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgagtcagtcgcagcggcagtcacattggcagtccctgagcctggcccgaagcctg
ggccacgtgctggcgggcgcggcgatatccatcgcgctgactttggcgccgcaaggcgcc
atggccaggcagtcgcccgacgacgtgcagggggtggtgggaaccatcgccgcacagcaa
ctgcccaacgaggcacggcagacgctggagcgtatcgaggccggtgggccgttcccgtat
gacaaggacggttcgcgctttggcaactacgagcgcagcctgccgcagcaatctcgcggg
tattaccgcgagtacaccgtcaagaacagcaatagccggaaccggggagccaagcggatc
gtttgcggtggtgatcaacgcgccgccaacgactgttattacacggaagaccactacaac
agcttcaaacggataaccaaatga

DBGET integrated database retrieval system