KEGG   Cupriavidus metallidurans: Rmet_3162Help
Entry
Rmet_3162         CDS       T00351                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rme  Cupriavidus metallidurans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Rmet_3162 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rmet_3162 (paaF)
   00650 Butanoate metabolism
    Rmet_3162 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    Rmet_3162 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rmet_3162 (paaF)
   00310 Lysine degradation
    Rmet_3162 (paaF)
   00360 Phenylalanine metabolism
    Rmet_3162 (paaF)
   00380 Tryptophan metabolism
    Rmet_3162 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rmet_3162 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rmet_3162 (paaF)
   00281 Geraniol degradation
    Rmet_3162 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_3162 (paaF)
   00627 Aminobenzoate degradation
    Rmet_3162 (paaF)
   00930 Caprolactam degradation
    Rmet_3162 (paaF)
Enzymes [BR:rme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rmet_3162 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3433325..3434101)
Genome map
AA seq 258 aa AA seqDB search
MSYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALTAFDQDEAIGCIVITGSERA
FAAGADISMMAKYSYMDVYKGDYITRNWETIRRIRKPVIAAVAGYALGGGCELAMMCDIV
IAADSAKFGQPEVKLGTMPGAGGTQRLPRAVSKAKAMDLCLTARMMDATEAERAGLVSRI
VPADKLVDEAVAAAETIAGYSLPVVMMIKESVNAAYETTLNEGVHFERRLFHSTFATEDQ
KEGMAAFVEKRAPNFQNR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacgagaacatcctggtggagacgcgaggtcgcgttggtctggtgacgctgaac
cggcccaaagcgctcaatgcgctcaatgacgcgctgatggacgaactgggcgcggcgctg
acggcattcgaccaggacgaggcaatcggctgcatcgtcatcacggggagcgagcgtgcc
ttcgccgcaggggccgatatcagcatgatggcgaagtactcctatatggatgtctacaag
ggcgactacatcacccgcaactgggagacaatccgccgcatccgcaaaccggtgatcgcc
gccgtggccggctatgcgctgggcggtggttgcgaactggcgatgatgtgcgacattgtg
attgccgccgacagcgcgaagttcggccagccggaagtgaagctcggcacgatgcctggc
gccggcggcacgcagcggctgccgcgtgccgtctccaaggccaaggcgatggacctgtgc
ctgaccgcgcgcatgatggatgccaccgaggccgagcgcgccgggctggtttcccggatc
gtcccggcagacaaactggtagacgaagccgtggccgcggccgagactatcgccggttac
tcgctgccggttgtcatgatgatcaaggagtcggtgaacgctgcctatgagacgactctg
aatgaaggggtccacttcgagcgccgactgttccactcgaccttcgccaccgaagaccag
aaggagggtatggcagcgtttgtggagaagcgtgcacccaatttccagaatcggtga

DBGET integrated database retrieval system