KEGG   Cupriavidus metallidurans: Rmet_3190Help
Entry
Rmet_3190         CDS       T00351                                 

Gene name
dsbC
Definition
Protein-disulfide isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rme  Cupriavidus metallidurans
Brite
Enzymes [BR:rme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Rmet_3190 (dsbC)
Secretion system [BR:rme02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Rmet_3190 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3465301..3466059)
Genome map
AA seq 252 aa AA seqDB search
MFQMFRRRSARFAAIAALASGVGAAGYALHALAADEPGTDRIKASIQKILGGRAEVKSVT
KAPVPGLYEVNVSGQLVYTDATGRYIINGELIDTKTNTNLTEERLAELNKIKWSDLPLSR
AIKWTKGDGSRTVAVFSDPNCGYCKKIEQTFQQMDNITVYTFLYPVLSPDSTVKAKQVWC
SADRTKVWRDWMLNHVALTGNGSCKTPVDENLELGHNLNITGTPAVFFSDGTRIPGAADA
ATLERKLASLKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaatgttccgccgccgttccgctcgcttcgccgcaatcgcggctctggcaagc
ggcgtgggcgccgccggctatgccctgcacgcgctggccgcggacgagccgggcacggat
cgcatcaaggcgtcgatccagaagatcctgggtggccgcgccgaggtcaagagcgtgacc
aaggcgccggtgccaggcctgtacgaagtcaacgtcagcggccagcttgtctataccgac
gccaccggtcgctacatcatcaacggcgaactgatcgacaccaagaccaacacgaacctg
accgaggagcgtctggccgagttgaacaagatcaagtggtcggatctgccgctgtcgcgc
gccatcaagtggaccaagggtgacggcagccgcaccgtggcggtgttctcggacccgaac
tgcggctactgcaagaagatcgagcagaccttccagcagatggacaacatcacggtctac
accttcctctatccggtgctgtcgccggattccacggtgaaggcaaagcaggtgtggtgc
tcggccgatcgcaccaaggtctggcgcgactggatgctgaaccacgtggcgctcaccggc
aacggatcctgcaagacgccggtcgatgagaacctcgagcttggccacaacctgaacatc
acgggcacgccggcggtgttcttctccgatggcacgcgaatccctggagccgctgacgcg
gccacgctggaacgcaagctcgccagcctgaaaaaataa

DBGET integrated database retrieval system