KEGG   Cupriavidus metallidurans: Rmet_3467Help
Entry
Rmet_3467         CDS       T00351                                 

Definition
putative bifunctional P-450:NADPH-P450 reductase 2 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
rme  Cupriavidus metallidurans
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rme00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rme00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rme00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3744390..3747584)
Genome map
AA seq 1064 aa AA seqDB search
MSTATPAAALEPIPRDPGWPIFGNLFQITPGEVGQHLLARSRHHDGIFELDFAGKRVPFV
SSVALASELCDATRFRKIIGPPLSYLRDMAGDGLFTAHSDEPNWGCAHRILMPAFSQRAM
KAYFDVMLRVANRLVDKWDRQGPDADIAVADDMTRLTLDTIALAGFGYDFASFASDELDP
FVMAMVGALGEAMQKLTRLPIQDRFMGRAHRQAAEDIAYMRNLVDDVIRQRRVSPTSGMD
LLNLMLEARDPETDRRLDDANIRNQVITFLIAGHETTSGLLTFALYELLRNPGVLAQAYA
EVDTVLPGDALPVYADLARMPVLDRVLKETLRLWPTAPAFAVAPFDDVVLGGRYRLRKDR
RISVVLTALHRDPKVWANPERFDIDRFLPENEAKLPAHAYMPFGQGERACIGRQFALTEA
KLALALMLRNFAFQDPHDYQFRLKETLTIKPDQFVLRVRRRRPHERFVTRQASQAVADAA
QTDVRGHGQAMTVLCASSLGTARELAEQIHAGAIAAGFDAKLADLDDAVGVLPTSGLVVV
VAATYNGRAPDSARKFEAMLDADDASGYRANGMRLALLGCGNSQWATYQAFPRRVFDFFI
TAGAVPLLPRGEADGNGDFDQAAERWLAQLWQALQADGAGTGGLGVDVQVRSMAAIRAET
LPAGTQAFTVLSNDELVGDPSGLWDFSIEAPRTSTRDIRLQLPPGITYRTGDHIAVWPQN
DAQLVSELCERLDLDPDAQATISAPHGMGRGLPIDQALPVRQLLTHFIELQDVVSRQTLR
ALAQATRCPFTKQSIEQLASDDAEHGYATKVVARRLGILDVLVEHPAIALTLQELLACTV
PMRPRLYSIASSPLVSPDVATLLVGTVCAPALSGRGQFRGVASTWLQHLPPGARVSASIR
TPNPPFAPDPDPAAPMLLIGPGTGIAPFRGFLEERALRKMAGNAVTPAQLYFGCRHPQHD
WLYREDIERWAGQGVVEVHPAYSVVPDAPRYVQDLLWQRREQVWAQVRDGATIYVCGDGR
RMAPAVRQTLIEIGMAQGGMTDKAASDWFGGLVAQGRYRQDVFN
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcaacacctgccgctgccctcgagccgattccccgcgatccgggctggccg
atcttcggcaacctgttccagatcacgccgggcgaggtcggccagcatttgctggcgcgt
agccgccaccacgatggcatcttcgaactcgacttcgccggcaagcgcgtgccgttcgtg
tcgtcggtcgcgctggccagcgagttgtgcgacgccacgcgctttcgcaagatcatcggg
ccaccgctgtcctacctgcgcgacatggccggcgacggcctgttcaccgcgcacagcgac
gagccgaactggggctgcgcgcaccgcattctgatgccggcgttcagccagcgggcgatg
aaagcctacttcgacgtgatgctgcgtgtggctaaccggctggtggacaaatgggaccga
cagggcccggacgccgatatcgccgtggcggacgacatgacgcgcctgacgctcgacacc
atcgcgctggcgggcttcgggtacgacttcgcatcgtttgcgagtgacgaactcgatccg
ttcgtgatggcgatggtcggcgcgctgggggaggcgatgcagaagctcacgcgcctgccg
atccaggatcgcttcatgggccgcgcgcatcgccaggccgccgaggacatcgcatacatg
cgcaatctggtcgatgacgtgattcgccagcggcgcgtgtcgccaacgtcgggcatggat
ctgctgaacctgatgctcgaagcgcgcgatcccgagaccgaccggcggctcgacgacgcc
aacatccgcaatcaggtcatcacgttcctgattgccggccacgaaaccaccagcggcttg
ctcacgttcgcgctctatgaactgctgcgcaatccgggcgtgctggcgcaggcgtatgcc
gaagtcgacacagtgctgcccggcgatgcgctgccggtctatgccgatctggcgcgtatg
cccgtgctcgaccgcgtgctgaaggaaacgctgcggttgtggccgaccgcacccgccttc
gcggtggcgccgttcgatgacgtggtgctgggcggccgctaccggctgcgcaaggaccgt
cgcatctcggtggtgctgaccgcgctgcatcgcgatccgaaggtctgggcgaaccccgag
cgtttcgatatcgaccgcttcctgcccgagaacgaggcgaagcttcccgcccatgcctat
atgccatttggacagggcgagcgcgcgtgcatcggccgccagttcgcgctgaccgaagcc
aagctcgcgctggcgctgatgttgcgcaactttgcgttccaggacccgcacgactaccag
ttccggctcaaggaaacgttgacgatcaagcccgatcagttcgtgctgcgcgtgcggcga
cgcaggccacacgagcggttcgtgacccggcaggcatcgcaggccgttgccgacgcggcg
cagacagacgttcgcggccatgggcaggcgatgaccgtgctgtgcgcatcgagtctcggc
acggctcgcgaactggctgagcagatccatgccggcgccattgcggcgggcttcgacgcg
aagctggccgacctcgacgacgccgtaggcgtcttgcccacttcgggcctggtcgtcgtc
gtggccgctacctacaacggccgcgcgcccgattcggctcgcaaattcgaagcgatgctc
gacgcggacgatgccagtggctaccgcgcgaatggaatgcggctggcgctgctcggctgc
ggcaattcgcagtgggcgacgtaccaggcgttcccacgtcgcgtgttcgatttctttatt
accgcgggtgcggtgccgctgctgccgcgtggcgaagccgatggcaatggcgacttcgat
caggcggccgagcgctggctcgcgcaactctggcaggcgctgcaggccgacggcgcgggc
accggtggcctcggcgtggacgtgcaggtgcgcagcatggcggcaatccgcgctgaaacg
ctgccagccggcacgcaggcgttcacggtgctgtcaaacgacgaactggtaggcgacccg
agcggcctgtgggatttctcgatcgaggcgccgcgcacgtcgacgcgcgatatccggctg
caactgcctccgggcatcacgtatcgcaccggcgatcacatcgcggtgtggccgcagaac
gatgcgcaactcgtttccgagttgtgcgagcggctcgatctcgatcccgatgcgcaggcc
acgatctccgcaccacacggcatggggcgtggcctgccaatcgaccaggcgttgccggtg
cggcaactgctgacgcacttcattgagctgcaggacgtggtctcgagacagacgctgcgt
gcgttggcgcaggccacgcgctgccctttcacaaagcagtcgatcgaacaacttgcttcg
gacgacgcggagcatgggtacgccacgaaggtggtcgcgcggcggctgggcatcctcgat
gtgctggtcgaacatccggcgatcgcgctgacgcttcaggaactgctggcgtgtactgtg
ccgatgcggccgcgcctttactcgattgcatcgtcgccgctggtatcgcccgatgtggcg
acgctactggtcggcaccgtctgcgcgccggcgttgtccgggcgcgggcagttccgtggc
gtggcgtcgacgtggctccagcatctgccgcccggcgcgcgggtatccgcgtcgattcgc
acgccgaatccgccgttcgccccggaccccgacccggcggcgccaatgctgctgatcggt
ccgggcaccggcatcgcgccgttccgcggattcctggaggaacgcgcgttgcggaagatg
gcgggcaatgcggtgacgccggcgcagctctacttcggctgccgccatccgcaacatgac
tggctctatcgcgaggacatcgaacgctgggccgggcagggtgtggtggaggttcacccg
gcgtactcagtcgtgccggatgcaccgcgctatgtgcaggatctgctctggcagcggcgc
gagcaggtctgggcgcaggtacgggacggcgcgacgatctacgtctgcggcgatggccgc
cgcatggcgccagcggtacgccagacactgatcgagatcggcatggcgcagggtggcatg
accgataaggcggcgtccgactggtttggcggtctcgtcgcgcagggccgctatcggcag
gatgtcttcaactga

DBGET integrated database retrieval system