KEGG   Cupriavidus metallidurans: Rmet_3467Help
Entry
Rmet_3467         CDS       T00351                                 

Definition
putative bifunctional P-450:NADPH-P450 reductase 2 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
rme  Cupriavidus metallidurans
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Rmet_3467
  Amino acid metabolism
   00380 Tryptophan metabolism
    Rmet_3467
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rmet_3467
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Rmet_3467
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Rmet_3467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3744390..3747584)
Genome map
AA seq 1064 aa AA seqDB search
MSTATPAAALEPIPRDPGWPIFGNLFQITPGEVGQHLLARSRHHDGIFELDFAGKRVPFV
SSVALASELCDATRFRKIIGPPLSYLRDMAGDGLFTAHSDEPNWGCAHRILMPAFSQRAM
KAYFDVMLRVANRLVDKWDRQGPDADIAVADDMTRLTLDTIALAGFGYDFASFASDELDP
FVMAMVGALGEAMQKLTRLPIQDRFMGRAHRQAAEDIAYMRNLVDDVIRQRRVSPTSGMD
LLNLMLEARDPETDRRLDDANIRNQVITFLIAGHETTSGLLTFALYELLRNPGVLAQAYA
EVDTVLPGDALPVYADLARMPVLDRVLKETLRLWPTAPAFAVAPFDDVVLGGRYRLRKDR
RISVVLTALHRDPKVWANPERFDIDRFLPENEAKLPAHAYMPFGQGERACIGRQFALTEA
KLALALMLRNFAFQDPHDYQFRLKETLTIKPDQFVLRVRRRRPHERFVTRQASQAVADAA
QTDVRGHGQAMTVLCASSLGTARELAEQIHAGAIAAGFDAKLADLDDAVGVLPTSGLVVV
VAATYNGRAPDSARKFEAMLDADDASGYRANGMRLALLGCGNSQWATYQAFPRRVFDFFI
TAGAVPLLPRGEADGNGDFDQAAERWLAQLWQALQADGAGTGGLGVDVQVRSMAAIRAET
LPAGTQAFTVLSNDELVGDPSGLWDFSIEAPRTSTRDIRLQLPPGITYRTGDHIAVWPQN
DAQLVSELCERLDLDPDAQATISAPHGMGRGLPIDQALPVRQLLTHFIELQDVVSRQTLR
ALAQATRCPFTKQSIEQLASDDAEHGYATKVVARRLGILDVLVEHPAIALTLQELLACTV
PMRPRLYSIASSPLVSPDVATLLVGTVCAPALSGRGQFRGVASTWLQHLPPGARVSASIR
TPNPPFAPDPDPAAPMLLIGPGTGIAPFRGFLEERALRKMAGNAVTPAQLYFGCRHPQHD
WLYREDIERWAGQGVVEVHPAYSVVPDAPRYVQDLLWQRREQVWAQVRDGATIYVCGDGR
RMAPAVRQTLIEIGMAQGGMTDKAASDWFGGLVAQGRYRQDVFN
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcaacacctgccgctgccctcgagccgattccccgcgatccgggctggccg
atcttcggcaacctgttccagatcacgccgggcgaggtcggccagcatttgctggcgcgt
agccgccaccacgatggcatcttcgaactcgacttcgccggcaagcgcgtgccgttcgtg
tcgtcggtcgcgctggccagcgagttgtgcgacgccacgcgctttcgcaagatcatcggg
ccaccgctgtcctacctgcgcgacatggccggcgacggcctgttcaccgcgcacagcgac
gagccgaactggggctgcgcgcaccgcattctgatgccggcgttcagccagcgggcgatg
aaagcctacttcgacgtgatgctgcgtgtggctaaccggctggtggacaaatgggaccga
cagggcccggacgccgatatcgccgtggcggacgacatgacgcgcctgacgctcgacacc
atcgcgctggcgggcttcgggtacgacttcgcatcgtttgcgagtgacgaactcgatccg
ttcgtgatggcgatggtcggcgcgctgggggaggcgatgcagaagctcacgcgcctgccg
atccaggatcgcttcatgggccgcgcgcatcgccaggccgccgaggacatcgcatacatg
cgcaatctggtcgatgacgtgattcgccagcggcgcgtgtcgccaacgtcgggcatggat
ctgctgaacctgatgctcgaagcgcgcgatcccgagaccgaccggcggctcgacgacgcc
aacatccgcaatcaggtcatcacgttcctgattgccggccacgaaaccaccagcggcttg
ctcacgttcgcgctctatgaactgctgcgcaatccgggcgtgctggcgcaggcgtatgcc
gaagtcgacacagtgctgcccggcgatgcgctgccggtctatgccgatctggcgcgtatg
cccgtgctcgaccgcgtgctgaaggaaacgctgcggttgtggccgaccgcacccgccttc
gcggtggcgccgttcgatgacgtggtgctgggcggccgctaccggctgcgcaaggaccgt
cgcatctcggtggtgctgaccgcgctgcatcgcgatccgaaggtctgggcgaaccccgag
cgtttcgatatcgaccgcttcctgcccgagaacgaggcgaagcttcccgcccatgcctat
atgccatttggacagggcgagcgcgcgtgcatcggccgccagttcgcgctgaccgaagcc
aagctcgcgctggcgctgatgttgcgcaactttgcgttccaggacccgcacgactaccag
ttccggctcaaggaaacgttgacgatcaagcccgatcagttcgtgctgcgcgtgcggcga
cgcaggccacacgagcggttcgtgacccggcaggcatcgcaggccgttgccgacgcggcg
cagacagacgttcgcggccatgggcaggcgatgaccgtgctgtgcgcatcgagtctcggc
acggctcgcgaactggctgagcagatccatgccggcgccattgcggcgggcttcgacgcg
aagctggccgacctcgacgacgccgtaggcgtcttgcccacttcgggcctggtcgtcgtc
gtggccgctacctacaacggccgcgcgcccgattcggctcgcaaattcgaagcgatgctc
gacgcggacgatgccagtggctaccgcgcgaatggaatgcggctggcgctgctcggctgc
ggcaattcgcagtgggcgacgtaccaggcgttcccacgtcgcgtgttcgatttctttatt
accgcgggtgcggtgccgctgctgccgcgtggcgaagccgatggcaatggcgacttcgat
caggcggccgagcgctggctcgcgcaactctggcaggcgctgcaggccgacggcgcgggc
accggtggcctcggcgtggacgtgcaggtgcgcagcatggcggcaatccgcgctgaaacg
ctgccagccggcacgcaggcgttcacggtgctgtcaaacgacgaactggtaggcgacccg
agcggcctgtgggatttctcgatcgaggcgccgcgcacgtcgacgcgcgatatccggctg
caactgcctccgggcatcacgtatcgcaccggcgatcacatcgcggtgtggccgcagaac
gatgcgcaactcgtttccgagttgtgcgagcggctcgatctcgatcccgatgcgcaggcc
acgatctccgcaccacacggcatggggcgtggcctgccaatcgaccaggcgttgccggtg
cggcaactgctgacgcacttcattgagctgcaggacgtggtctcgagacagacgctgcgt
gcgttggcgcaggccacgcgctgccctttcacaaagcagtcgatcgaacaacttgcttcg
gacgacgcggagcatgggtacgccacgaaggtggtcgcgcggcggctgggcatcctcgat
gtgctggtcgaacatccggcgatcgcgctgacgcttcaggaactgctggcgtgtactgtg
ccgatgcggccgcgcctttactcgattgcatcgtcgccgctggtatcgcccgatgtggcg
acgctactggtcggcaccgtctgcgcgccggcgttgtccgggcgcgggcagttccgtggc
gtggcgtcgacgtggctccagcatctgccgcccggcgcgcgggtatccgcgtcgattcgc
acgccgaatccgccgttcgccccggaccccgacccggcggcgccaatgctgctgatcggt
ccgggcaccggcatcgcgccgttccgcggattcctggaggaacgcgcgttgcggaagatg
gcgggcaatgcggtgacgccggcgcagctctacttcggctgccgccatccgcaacatgac
tggctctatcgcgaggacatcgaacgctgggccgggcagggtgtggtggaggttcacccg
gcgtactcagtcgtgccggatgcaccgcgctatgtgcaggatctgctctggcagcggcgc
gagcaggtctgggcgcaggtacgggacggcgcgacgatctacgtctgcggcgatggccgc
cgcatggcgccagcggtacgccagacactgatcgagatcggcatggcgcagggtggcatg
accgataaggcggcgtccgactggtttggcggtctcgtcgcgcagggccgctatcggcag
gatgtcttcaactga

DBGET integrated database retrieval system