KEGG   Cupriavidus metallidurans: Rmet_3693Help
Entry
Rmet_3693         CDS       T00351                                 

Gene name
cheB1
Definition
(RefSeq) chemotaxis protein CheB
  KO
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rme  Cupriavidus metallidurans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rmet_3693 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rmet_3693 (cheB1)
Enzymes [BR:rme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rmet_3693 (cheB1)
Two-component system [BR:rme02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rmet_3693 (cheB1)
Bacterial motility proteins [BR:rme02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rmet_3693 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
megaplasmid:232620..233693
Genome map
AA seq 357 aa AA seqDB search
MTAAKIKVLCVDDSALIRSLMSEIINSQPDMEVVGTAPDPLVARDLIKRVNPDVLTLDVE
MPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELGAVDFVTKPKLGIREGLLD
YTQTIADKIRAASRARVRARAEQSAGAAPVAPMLRAPLLSTEKLIIVGASTGGTEAIKDF
LTPLPPDSPAVMIVQHMPAGFTKSFAHRLNGLCRITVKEAEHGERVLPGYAYIAPGDSHL
LLARSGANYVAHLSQEAPVNRHRPSVDVLFDSAAIHGGKNVTGVILTGMGKDGARGMLRM
REAGAYNLAQDEQSCIVFGMPKEAIAAGGVHEVVPLHQMSQRVMAHLATFGARAQRV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgcgaagatcaaggtgctgtgcgtggacgattccgcgctgatacgcagcctg
atgtcggaaatcatcaacagccagccggacatggaggtggtgggtaccgccccggatccg
ctggtggcgcgcgacctgatcaagcgcgtcaatccggacgtgctgacgctggacgtagaa
atgccgcgtatggacggcctggattttcttgagcgcctgatgcgcctgcggccgatgccg
gtgctcatggtgtcgtcgctgaccgagcgtgggtccgagatcacgatgcgcgcgctggaa
cttggcgccgtggacttcgtgaccaagccgaagctcggtatccgcgaaggcctgctggac
tacacgcagacgatcgcggacaagatccgcgccgcatcgcgcgcccgcgtgcgtgcgcgt
gcggagcagagcgctggcgcggcgcccgtcgcgccgatgctgcgcgcgccgctgttgtcg
acggaaaagctgatcatcgtcggggcctccacggggggcaccgaggcgatcaaggatttc
ctgacgccgctaccgcccgattccccagcggtcatgatcgtccagcacatgccggcaggt
ttcacgaagtcgttcgcgcaccgcctgaacggcctgtgccgcatcacggtcaaggaagcc
gagcatggcgagcgtgtgctgccgggctatgcgtacatcgcgcccggcgattcgcacctg
ctgctggcgcgtagcggtgcgaactacgtggcgcacctgtctcaggaagcgccggtcaat
cggcaccgaccgtccgtggatgtgctgttcgattccgccgcgattcacggtggcaagaac
gtcacgggcgtgatcctgaccggcatgggcaaggacggcgcgcgcggcatgttgcgcatg
cgcgaggcaggcgcctacaacctggcgcaggacgagcaatcctgcatcgtgtttggtatg
ccgaaggaagccatcgcggccggcggtgtgcatgaagtggtgcccctgcaccagatgagc
cagcgcgtcatggcgcacctggctacgtttggcgcgcgggcgcagcgcgtatag

DBGET integrated database retrieval system