KEGG   Cupriavidus metallidurans: Rmet_3926Help
Entry
Rmet_3926         CDS       T00351                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rme  Cupriavidus metallidurans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmet_3926
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rmet_3926
Enzymes [BR:rme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rmet_3926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
megaplasmid:complement(485101..486009)
Genome map
AA seq 302 aa AA seqDB search
MKPVTLIGAPTDVGASIRGASMGPEALRVADIAGALVRNGLDVTDLGNLVGPGNPNLPPT
DGVRHLPEVVAWNRLVMDATYQALATGQLPLLMGGDHCLAIGSVNAAARYCREQGKKLLV
LWLDAHADANTGSTSPTGNTHGMPVACLCGDGPAPLVSLGGVTPATSPRNIRQIGIRSVD
AEEKKRLRELGLTVYDMRYIDENGMRATMEQALAGIDGDTHLHVSFDVDFLDSQIAPGVG
TAVRGGPTYREAHLALEMIEDTGALGSIDVVELNPARDVHNQTAELVVELLESLFGKSTL
LR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgtcaccctgattggcgcgccgaccgacgtgggcgccagcatccgtggcgcc
tcgatgggccccgaagccttgcgcgtggcggacatcgccggcgccctggtgcgcaacggc
ctcgatgtcaccgatctgggcaacctcgtgggccctggcaaccctaacctgccacccacg
gatggcgttcggcacctgccggaggttgtcgcctggaaccgtctggtcatggacgccaca
taccaggccctggccaccggccagttgccgctgctgatgggtggcgaccactgcctggcg
attggctcggtcaatgccgcggctcgctattgccgcgagcagggaaagaagctcttggtg
ctctggcttgatgcgcacgccgatgccaacaccggcagcaccagcccgaccgggaacacc
catggcatgccggtggcgtgcctgtgcggggatggtcccgccccgcttgtgtcactaggc
ggcgtgacgcccgccacctcaccccggaacattcggcagatcggcatccgcagtgtcgat
gccgaggagaaaaagcggctgcgtgagttgggcctgaccgtctacgacatgcgctacatc
gacgagaacggcatgagggccacaatggagcaggcgttggcgggcatcgatggcgatacc
catctgcatgtcagcttcgacgtggatttcctcgacagccagattgcgccgggcgtcggc
acggcggttcgcggtggccctacctatcgagaagcgcatctcgcactggaaatgatcgaa
gacaccggcgccctgggctccatcgacgtggtcgaactgaacccagcgcgcgacgtccac
aaccagaccgccgagctggtcgtcgaattactggagagcctgttcgggaaatcgacgctg
ctgcgttga

DBGET integrated database retrieval system