KEGG   Cupriavidus metallidurans: Rmet_4031Help
Entry
Rmet_4031         CDS       T00351                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rme  Cupriavidus metallidurans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rmet_4031
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rmet_4031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
megaplasmid:600612..601001
Genome map
AA seq 129 aa AA seqDB search
MKYALPLVLALLVHPVANAANAANATVGNVQTGKETFTRLCASCHRVGPSARGAFGPQLN
GVFGRKAGSTADYRYSDAMKTSNVVWSDATLGAFVQSPGKVVPGTKMRFWGMSDPQQIAD
LLAYLRTFQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgcattacccctcgttcttgccctgcttgtccatccagtcgccaacgcagcc
aatgcagccaatgccaccgtcggtaatgtccagactggcaaggagaccttcactcggctc
tgcgcctcatgccaccgcgtcggcccgtcggcgcgtggcgcattcggaccccagctcaat
ggcgtgttcggtcgcaaggccggcagtacggcggattatcgttattccgatgcgatgaag
acgtcgaacgtggtctggtcggatgccacgctgggtgcctttgtacagtcgccaggcaag
gtggtgccgggcacgaagatgcgtttctggggcatgagcgatccgcagcagatcgccgat
cttcttgcttacctacgcaccttccaatag

DBGET integrated database retrieval system