KEGG   Cupriavidus metallidurans: Rmet_4084Help
Entry
Rmet_4084         CDS       T00351                                 

Gene name
phoA1
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rme  Cupriavidus metallidurans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rme00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rme00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rme02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
megaplasmid:651730..653190
Genome map
AA seq 486 aa AA seqDB search
MRRISVLAAAAMSVALAACGGDDNNGNNAGTTPPIEQPQGGTTPTKNVVFFLGDGMGMTT
LTAARIYKVGEEGDLTIDTMPESGFVRTYSNDAQVTDSAPSMAAYMTGVKMNNEVISMTP
ETSAVDANGKAYVSGADSTCPATGNGKSVPTLLEQMKAAGYGTGVVTTTRITHATPAATY
AHICHRDGENAIAAQLVPKGAGFNGALTDGVDVIFGGGRQHFLATTAGGKRTDGRDLVGE
FKTAGYSYAASKSDFDKITASSAKVVGLFNASHMDYDLDRDPAKEPSLAEMTGKAIDVLA
AKKKGFFLMVEGGRIDHALHETTARKALQDTAAFDDAIKAAIDKLNVIDPGLKNTLIVVT
ADHDHTLVLNGYAKRTGKTSDANPGVLGLVKDYVTGSAKLDSTGNPFSIIGFGNGENRPA
TRTALTDVQVFDKTYHQEAVIPMPAGGETHGGTDVFIGAMGNGATSFTGVMDNIEVFGLI
KKAIGL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggatttccgtactcgcggcagccgccatgtcggtcgccctcgcggcctgcggc
ggcgatgacaacaatggcaacaacgccggcacgacgccgccgatcgagcagccacaaggc
ggcaccacgccgaccaagaacgtcgtatttttcctcggcgacggcatgggcatgacgacg
ttgaccgccgcgcgtatctacaaggtgggcgaggaaggcgatctgacgatcgacacgatg
ccggaaagcggcttcgtccgtacgtattcgaacgacgcccaggtcacggacagcgccccg
tcgatggccgcctacatgaccggcgtgaaaatgaacaacgaagtcatctcgatgactccg
gaaacgagcgccgtggacgccaacggcaaggcctatgtgtcgggcgctgacagcacctgc
ccggcgacgggcaacggcaagagcgtgccgacgctgctcgagcagatgaaggctgccggc
tacggcacgggcgtggtcactaccacgcgcatcacgcacgccacgccggcggccacctac
gcccacatctgccaccgcgacggcgagaacgccatcgcagcgcaactggtaccgaagggc
gccggcttcaacggcgcgctgaccgatggcgtcgacgtgatcttcggcggcggccgccag
cacttcctggccacgaccgcaggcggcaagcgtaccgatggccgcgatctggtcggcgag
ttcaagacggccggctatagctacgctgccagcaagtcggacttcgacaagatcacggcc
agctctgccaaggtggtgggtctgttcaacgcgagccacatggattacgacctcgatcgc
gatccggcgaaggagccgagcctggcagaaatgaccggcaaggccatcgacgtgctggct
gccaagaagaagggcttcttcctgatggtggaaggcggtcgtatcgaccacgcgctgcac
gagaccaccgcccgcaaggcactgcaggacaccgccgcgttcgacgacgcgatcaaggct
gccatcgacaagctcaacgtaatcgacccgggcctgaagaacacgctgatcgtcgtcacc
gccgaccatgaccacaccctggtcctgaacggctacgccaagcgcacgggcaagaccagc
gatgccaaccccggcgtgctgggtctggtcaaggactacgtgactggctctgccaagctc
gattcgaccggcaacccgttctcgatcatcggcttcggcaatggcgagaaccgtccggcc
acgcgtaccgcgctgaccgatgtgcaggtcttcgacaagacctatcaccaggaagcggtg
attccgatgcccgcgggtggtgaaacccacggtggcaccgatgtgttcatcggcgccatg
ggcaacggggccaccagcttcaccggtgtgatggacaacatcgaggtgttcggcctgatc
aagaaggcaatcggactctga

DBGET integrated database retrieval system