KEGG   Cupriavidus metallidurans: Rmet_4808Help
Entry
Rmet_4808         CDS       T00351                                 

Definition
di-heme cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rme  Cupriavidus metallidurans
Brite
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Rmet_4808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
megaplasmid:complement(1454856..1456223)
Genome map
AA seq 455 aa AA seqDB search
MTLPPLLWNAAFPSPITWLRAAGGLLIALLVSLTSGCGKQEAAAGTPAAAAQPVAVVSTA
SAPKPASPKPFYAMMAERRPNIPALTALGKTLFFDPALSASGKQSCASCHSPDHAYGPPN
DLSVQLGGVDMSRTGVRAAPSLRYVQNVPAYTDHYHENDGNDAEDQGPTGGHNWDGRANS
AHEQARIPLLSPHEMANGEPRVVVEKIRKGPHAETFRKVLGQDVLDDDDTAFNAVLMALE
VFQETPSEFYPYTSKYDAVLRGQAKLTPQEARGLRVFNDPNKGNCAACHPGDIREGAFPA
FSDFGFIAVGAPRNRKLAGNADPEFHDLGLCGPDRTDLKDRADYCGLFRTPSLRNVALRH
AFFHNGVFHSLDEVLHFYAERDVKPQKWYPRGKDGKVWKFDDLPEPYQANVNMEAPFGGK
PGDKPLMTEGEMRDVIAFLNTLTDGYKVPAAASVR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccgccgctgctttggaatgccgcgtttccctcgccgatcacgtggctgcgt
gccgcaggcggtctgttgatcgcgcttctggtcagcctgacctcgggctgcggcaagcag
gaggcggctgcgggcacgccggccgccgcagcgcaaccggtggcagtcgtcagcacggca
agcgcgccgaagcccgcaagtccgaagccgttctacgcaatgatggccgagcgtcggccc
aacatcccggccctgacggctctcggcaagacgctcttcttcgatccggcgctctcggcg
tcgggcaagcagtcgtgcgcgagttgccatagccccgatcacgcctatgggccgccgaat
gatctgtccgtgcaactcggcggcgttgacatgagccgcacgggcgtgcgtgccgcgccg
tcactgcgttacgtgcagaacgtgccggcctataccgaccactatcacgagaacgacggc
aacgacgccgaggatcagggtccgaccggtgggcacaactgggatggtcgcgcgaactcc
gcgcacgagcaggcgcgcatcccgttgctgtcgccgcacgagatggccaatggcgagccg
cgcgtggtggtcgagaagatccggaaggggccccatgccgagactttccgcaaggtgctg
gggcaggatgtgcttgacgatgacgataccgcgttcaatgcagtgctgatggccctggag
gtattccaggagacgccgtcggagttctatccctataccagcaagtacgacgccgtgctg
cgcgggcaggcaaagctgaccccccaggaggcacgcggcctgcgcgtcttcaacgatccg
aacaagggcaactgcgccgcgtgccatccgggcgatattcgcgagggcgcattcccggct
ttctcggatttcggattcatcgccgtgggtgcgccacgcaatcgcaagcttgccggcaat
gccgatccagaattccacgatttggggctctgcggcccggatcgcaccgatctcaaggat
cgtgccgactattgcggcctgttccggacgccgtcactgcgcaacgttgcactgcgtcat
gcgtttttccacaatggtgtattccattctctggacgaggtgctgcacttctacgccgaa
cgcgatgtgaagccgcagaagtggtacccgcgcggcaaggacggcaaggtgtggaagttc
gatgacctgcccgagccctatcaggccaacgtcaacatggaagccccgttcggcggcaag
cctggcgacaagcccttgatgaccgaaggggaaatgcgcgacgtgatcgcgtttctgaat
acgttgacggatggatacaaggtgccggcagcagcgtcggtgcgatga

DBGET integrated database retrieval system