KEGG   Cupriavidus metallidurans: Rmet_4842Help
Entry
Rmet_4842         CDS       T00351                                 

Definition
(GenBank) putative ABC transporter, inner membrane component
  KO
K02053  
putative spermidine/putrescine transport system permease protein
Organism
rme  Cupriavidus metallidurans
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:rme00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rmet_4842
Transporters [BR:rme02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    Rmet_4842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
megaplasmid:1499384..1500259
Genome map
AA seq 291 aa AA seqDB search
MTSKPRRTAYWLQLTLTLAVCAFMTVPVVLSVLAGLTNNIFVGLSSGLTTRWLVEVWSLY
RNTIFLSLGIALACLACTLVIGVPAAYYMALRRNRVTRLIEELLMLPVAVPGLATALGLI
LLYGGWQALRTSWVFILIGHVLFTLPFMVRSVLAILSAIDIRTIEDAAASLGATRLQRFF
TVVLPNCRQGILAGALMVVTLSVGEFNLTWMLHTPTTQTLPVGLADSYASMRLEIGSAYT
IVFFVMIIPLLVFMQALSALGARARRHAPPPEATAELPMTAVPQSAETRHA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaaaaccccgccgcaccgcctattggctgcaactgacactcacactcgcggtc
tgcgcgttcatgacggtgcccgtggtgctgtccgtgctggccggcctgaccaacaacatc
tttgtcggcctatcgagcggcctgactacccgctggctggtcgaagtctggtcgctctac
cgcaacacgatctttctttcgctgggtatcgcgctggcctgtctggcctgcaccctcgtg
atcggcgtgccggccgcgtactacatggcgctgcggcgcaaccgcgtgacccggctgatc
gaggaactgctgatgctgcccgtcgccgtgcctgggctggccactgcactgggcttgatc
ctgctttacggcggctggcaggcactgcggacgagctgggtgtttatcctgatcggacac
gtgctgttcacgctgccgttcatggtccgatcggtgctggcgattctctccgccattgac
atccgcacgatcgaggatgctgccgcgagtctgggcgccacgcgcctgcagcgcttcttc
acggtggtgctgcccaattgccgccagggcatcctggccggcgcgctgatggtggtgacg
ttgtcggtgggcgaattcaacctgacgtggatgctccatacgcccaccacgcaaacgctc
ccggttgggctggccgacagctacgcgtccatgcggctggaaatcggctcggcctacacc
atcgtcttcttcgtgatgatcattccgctgctggtgttcatgcaggcgctgagcgcgttg
ggcgcgcgtgcccgccgccacgctcccccacctgaagccaccgcagaactgccgatgact
gccgtaccccaatccgccgagacccgccatgcatga

DBGET integrated database retrieval system