KEGG   Cupriavidus metallidurans: Rmet_4842Help
Entry
Rmet_4842         CDS       T00351                                 

Definition
ABC transporter, inner membrane component
Orthology
K02053  
putative spermidine/putrescine transport system permease protein
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
megaplasmid:1499384..1500259
Genome map
AA seq 291 aa AA seqDB search
MTSKPRRTAYWLQLTLTLAVCAFMTVPVVLSVLAGLTNNIFVGLSSGLTTRWLVEVWSLY
RNTIFLSLGIALACLACTLVIGVPAAYYMALRRNRVTRLIEELLMLPVAVPGLATALGLI
LLYGGWQALRTSWVFILIGHVLFTLPFMVRSVLAILSAIDIRTIEDAAASLGATRLQRFF
TVVLPNCRQGILAGALMVVTLSVGEFNLTWMLHTPTTQTLPVGLADSYASMRLEIGSAYT
IVFFVMIIPLLVFMQALSALGARARRHAPPPEATAELPMTAVPQSAETRHA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaaaaccccgccgcaccgcctattggctgcaactgacactcacactcgcggtc
tgcgcgttcatgacggtgcccgtggtgctgtccgtgctggccggcctgaccaacaacatc
tttgtcggcctatcgagcggcctgactacccgctggctggtcgaagtctggtcgctctac
cgcaacacgatctttctttcgctgggtatcgcgctggcctgtctggcctgcaccctcgtg
atcggcgtgccggccgcgtactacatggcgctgcggcgcaaccgcgtgacccggctgatc
gaggaactgctgatgctgcccgtcgccgtgcctgggctggccactgcactgggcttgatc
ctgctttacggcggctggcaggcactgcggacgagctgggtgtttatcctgatcggacac
gtgctgttcacgctgccgttcatggtccgatcggtgctggcgattctctccgccattgac
atccgcacgatcgaggatgctgccgcgagtctgggcgccacgcgcctgcagcgcttcttc
acggtggtgctgcccaattgccgccagggcatcctggccggcgcgctgatggtggtgacg
ttgtcggtgggcgaattcaacctgacgtggatgctccatacgcccaccacgcaaacgctc
ccggttgggctggccgacagctacgcgtccatgcggctggaaatcggctcggcctacacc
atcgtcttcttcgtgatgatcattccgctgctggtgttcatgcaggcgctgagcgcgttg
ggcgcgcgtgcccgccgccacgctcccccacctgaagccaccgcagaactgccgatgact
gccgtaccccaatccgccgagacccgccatgcatga

DBGET integrated database retrieval system