KEGG   Cupriavidus metallidurans: Rmet_5505Help
Entry
Rmet_5505         CDS       T00351                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00071  Fatty acid degradation
rme00280  Valine, leucine and isoleucine degradation
rme00281  Geraniol degradation
rme00310  Lysine degradation
rme00360  Phenylalanine metabolism
rme00362  Benzoate degradation
rme00380  Tryptophan metabolism
rme00410  beta-Alanine metabolism
rme00627  Aminobenzoate degradation
rme00640  Propanoate metabolism
rme00650  Butanoate metabolism
rme00903  Limonene and pinene degradation
rme00930  Caprolactam degradation
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01212  Fatty acid metabolism
Module
rme_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rmet_5505
   00650 Butanoate metabolism
    Rmet_5505
  Lipid metabolism
   00071 Fatty acid degradation
    Rmet_5505
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rmet_5505
   00310 Lysine degradation
    Rmet_5505
   00360 Phenylalanine metabolism
    Rmet_5505
   00380 Tryptophan metabolism
    Rmet_5505
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rmet_5505
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rmet_5505
   00281 Geraniol degradation
    Rmet_5505
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_5505
   00627 Aminobenzoate degradation
    Rmet_5505
   00930 Caprolactam degradation
    Rmet_5505
Enzymes [BR:rme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rmet_5505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABF12364
JGI: Rmet5505
UniProt: Q1LBW2
Position
megaplasmid:2249197..2250078
Genome map
AA seq 293 aa AA seqDB search
MRKWLRTTESIEFAVKGRVAYVTLNRPECRNALSPELLAEYRSALLEADDLRAVSAIVVA
GNGKDFCAGYDMKGAYARYASEHGDEASPYRTGIGSFDDDSWKLERSQEMLRTPFDIHKP
VIAKVHGNCVAGGTDLALYCDMIIAADNARIGFPATRAMGSPPNHMWIYNVGPQWAKRLL
LTGDVLLGKDAAKIGLAVSSIPESDLDQEVERLANSIGSLDPELLACNKRIVNLALEVGG
ASVLQRLAAEMDARAHLTRAKAEFDEDVRALGFKGAAEKRDKPFGDGVARLSW
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaagtggcttagaacaaccgagagcatcgagttcgccgtcaaaggccgtgttgca
tacgtgaccctaaacaggccagaatgccgcaatgcactgtcccccgaactcctcgctgag
taccggtcagccctgcttgaagcagatgatctccgggctgtaagtgctatcgtcgttgct
ggaaacggcaaggatttttgtgccggctatgacatgaagggagcctatgcccgttacgca
tccgagcacggcgatgaagcgagcccttatcgaaccggaatcggttcttttgacgatgac
tcctggaagctggaacgctcccaggaaatgctgcggaccccctttgacattcataaacct
gtcattgcgaaggttcacgggaactgcgtcgcgggtgggaccgacttagctctatactgc
gacatgatcatcgcagccgacaacgcccgcattgggtttcccgcgacacgtgcaatgggc
tccccgcccaaccacatgtggatctacaacgtcggcccgcaatgggcgaaaaggctattg
ctaactggcgacgtacttttaggcaaggatgcagcaaagatcggccttgctgtgagttcg
atccccgaaagcgacctcgaccaagaagtggagcgacttgccaacagcattggttcgctg
gaccctgagctgcttgcctgcaacaagcgaatcgttaacctggctctcgaagttggcggc
gcctctgtgcttcagcgcctggctgccgaaatggacgcgagagcccatctcacacgtgcc
aaggccgaatttgacgaagatgttcgtgcccttggattcaagggtgcagcagagaagcgc
gacaagcccttcggtgacggcgtcgcaaggctgagttggtag

DBGET integrated database retrieval system