KEGG   Cupriavidus metallidurans: Rmet_5545Help
Entry
Rmet_5545         CDS       T00351                                 

Definition
(GenBank) Alcohol dehydrogenase, NAD-dependent, Zn-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00010  Glycolysis / Gluconeogenesis
rme00071  Fatty acid degradation
rme00350  Tyrosine metabolism
rme00625  Chloroalkane and chloroalkene degradation
rme00626  Naphthalene degradation
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_5545
  Lipid metabolism
   00071 Fatty acid degradation
    Rmet_5545
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rmet_5545
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rmet_5545
   00626 Naphthalene degradation
    Rmet_5545
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rmet_5545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ThiF
Motif
Other DBs
NCBI-ProteinID: ABF12404
JGI: Rmet5545
UniProt: Q1LBS2
Position
megaplasmid:complement(2291628..2292686)
Genome map
AA seq 352 aa AA seqDB search
MKSYDIVEWGKPLQEVLRDRPKPVGTEVLVKVQACGICHSDLHIRDGLLDLGNGKHISFE
SVGVKLPFTMGHEIVGVVAEAGSEASVKAGTPCVVYPWHGCGTCLNCTNGREVDCESGRA
LGTRKPGGYSDYVVVPHEQYLLDYGNLDPLLAATCACSGLTSFSALKKLPPMLEADTLVL
IGAGGLGLAALGLAPQLTSARLVVADIDDEKLARASAAGAHEVVNLRSENAARDLRKAAP
NGIRAIVDFVGSAQTTGVALESVARGGTVVVVGLFGGAISLSTALLPMRNVTLRGSYVGS
VEEMRALLDLLQEKGKGSPVNLKSLPMSAVNEALEELAQGRVAGRLLAIPGQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagagctacgacatcgtggagtggggcaagcctctccaggaggttctgcgagacaga
ccaaagccggtcggtactgaggttctcgtaaaggtgcaagcctgtgggatttgccatagt
gacctccatattcgggatggcttgctggatcttggcaatgggaagcacatttctttcgag
agtgttggggtaaagctgccctttacgatgggccatgagatcgttggggtcgttgcagag
gctggcagtgaggcgtcagtcaaggcggggacgccttgtgttgtctacccgtggcacggt
tgcgggacttgtctgaattgcaccaacggccgtgaagttgactgtgagagtgggcgggcg
ctcggtacccgtaagccggggggatactctgactacgtcgtggtaccgcatgagcaatac
ctcctggattacggaaatctcgatccgctgcttgcagctacctgtgcctgttctgggcta
acctcgttcagtgcattgaagaagcttcctcccatgctcgaggcagacacgctagtacta
atcggcgctggcgggttagggctcgcggctcttggtttggcgccgcagctcacttctgcg
cggctagtggtcgcagacatcgatgacgaaaagctcgcccgcgcatcagcggcgggggca
catgaggtggtcaatcttcgctccgaaaacgcggctcgggatttgcgaaaagcagcgcca
aatgggattcgagcgattgtcgactttgtcggctcggcgcagacgacgggcgtggcgctg
gagagtgtggcccgcggaggcaccgtcgtcgtcgtgggcctttttgggggcgccatctct
ttgtcgactgcacttttgcccatgcggaacgtgactctgaggggctcctatgtcggctcg
gtggaggaaatgcgagcgcttttggatttgctacaagagaaaggaaagggttcgccggtc
aatctcaagtcgctcccaatgtctgcggtcaatgaggctttagaagagcttgcacaaggt
cgggttgctggccgtttgctggccatccctggtcagtga

DBGET integrated database retrieval system