KEGG   Cupriavidus metallidurans: Rmet_5799Help
Entry
Rmet_5799         CDS       T00351                                 

Gene name
glk
Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rme  Cupriavidus metallidurans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmet_5799 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_5799 (glk)
   00052 Galactose metabolism
    Rmet_5799 (glk)
   00500 Starch and sucrose metabolism
    Rmet_5799 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Rmet_5799 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rmet_5799 (glk)
   00524 Butirosin and neomycin biosynthesis
    Rmet_5799 (glk)
Enzymes [BR:rme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rmet_5799 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
megaplasmid:complement(2556964..2557974)
Genome map
AA seq 336 aa AA seqDB search
MTDRAMSYPRILADVGGTNVRFAMETAPMRIGEITAYKVAEHASLEAAMRLYMLTRSGAA
RPRHAAIGLANPVTGDQVKLTNHNWAFSVEAMRRALDLDTLVAINDFTSLALALPYLPDA
SLVQVRDGTAVATAPRALIGPGTGLGVSGLIPAPGGAVALAGEGGHIEIMPVTDDEWIAW
RAAHDQFGRVSAERLLSGMGLSHIHAALSAEMGTPLEVPLAPAQVTDGAMRAGDPVCRRA
FDAFCGMLGSVAADVALVLGARGGVYLGGGIVPRFVDALRASTFAERFVAKGRMGSFLAD
VPVYVITAEYPALPGLARALADRLEADARRAETSQS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgcgcgatgtcctatccccggatcctggccgacgtgggcggcaccaacgtg
cgctttgccatggagacggcgccgatgcggatcggcgagatcaccgcatacaaggtggcc
gagcacgcctcgctcgaagccgcgatgcggctctacatgctgacgcgtagcggcgcggcc
cggccgcgccatgcggccatcggcctggccaatccggtcactggtgaccaggtcaagctg
accaaccacaactgggcgttctccgtcgaggccatgcgccgcgcgctcgatctcgacacg
ctggtggccatcaacgacttcacctcgctggcgctggcgctgccgtatctgcccgacgcc
agccttgtgcaggtacgcgacggcacggcggtggccacggcgccccgggccttgatcggg
ccgggaaccggccttggcgtatccggcctgattcccgcgccgggtggcgcggtggcgctg
gcgggcgagggcggacacatcgagatcatgccggtcaccgacgacgagtggatcgcctgg
cgcgccgcccacgatcagtttgggcgcgtgtcggcggagcggctgctgtcgggtatgggt
ctctcgcatattcatgccgcgctgtccgcagaaatgggtacgcctctggaggtgccgctg
gcaccggcgcaggtgacggacggcgcgatgcgcgcgggcgacccggtatgccgccgcgct
ttcgacgcgttctgcgggatgctcggctcggttgccgccgatgtcgcgctggtgctcggc
gcacgtggtggcgtctatctcggcggtggtatcgttccacgctttgtcgatgccctacgg
gcgtcgacgttcgcggagcgctttgtcgccaagggccgcatgggcagtttccttgccgat
gtgccggtgtacgtgatcacggccgagtatccggcgctgccgggcctggctcgcgcactg
gcggatcggcttgaagccgacgcgcgccgcgccgagacctctcaatcctga

DBGET integrated database retrieval system