KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0119Help
Entry
Rhom172_0119      CDS       T01606                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:rmg01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rmg00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rmg00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rmg00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:rmg00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:rmg00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
125323..126339
Genome map
AA seq 338 aa AA seqDB search
MTRALPATMRAMVLEAPGRPLVLRELPVPEPGPGEVLLRVEACGVCRTDLHIVDGELPAP
KLPLIPGHQIVGRVVRSGEGVTRFREGDRVGVPWLAETCGTCRYCRRGQENLCPNARFTG
YTRDGGFAEFTTALADYCYPLPDDVYDAPHAAPLLCAGLIGYRTYRLAGPHVERLGLYGF
GAAAHLIIQVAVARGQQVYAFTRPGDTAAQAFARKLGAVWAGASTERPPEPLDAALIFAP
VGALVVEALRSVDKGGVVVCGGIHMSDIPSFPYRLLWEERVIRSVANLTRQDGEEFLKLA
PTIPVRTEVTCFPLEEANEALRRLREGQLQGAAVLVMR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgcgttgcctgctaccatgcgggccatggtgctggaggcccccggacgtccg
ctcgtgcttcgcgaactgcccgtgcccgaacccggaccgggcgaagtgctgcttcgggtg
gaggcgtgcggcgtgtgccgcaccgatctgcatatcgtggacggcgagctgcccgcgcct
aaactgccgctgattccagggcatcagatcgtgggacgggtggtgcgatcgggtgaaggg
gtgacccgctttcgggagggcgaccgcgtgggcgtgccctggctggccgagacgtgcgga
acgtgccgctattgccgtcggggccaggaaaacctgtgcccgaacgcccgcttcaccggc
tacacgcgcgacgggggctttgccgaattcaccacggccctggccgactactgttatccg
ctcccggatgatgtgtatgacgcgcctcacgcggcaccgctgctgtgcgccgggttgatc
ggctaccgcacctaccggctggccgggccgcatgtcgagcgcctgggcctgtacggcttt
ggtgcggccgcgcatctgatcatccaggtggccgtggcccgcggccagcaggtttacgcc
ttcacccggcccggcgacacggccgcgcaggcgttcgcccggaagctgggggccgtctgg
gccggtgcttcgacggagcgtccgccggagccgcttgatgccgccctgattttcgcgccg
gtaggggcgctggtggtcgaggcgctccggtcggtagataaggggggggtagtggtgtgc
ggcggcatccacatgagcgacatcccgtcgttcccttaccgactgctctgggaggaacgc
gtcatccgctcggtggccaacctgacgcgtcaggacggcgaggaattcctgaagctggcg
cccaccattcccgtacgtaccgaggtgacgtgttttccgctggaagaggccaacgaggcg
cttcggcgactccgcgaaggccagctccagggcgccgccgtgctggtgatgcgatag

DBGET integrated database retrieval system