KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0119Help
Entry
Rhom172_0119      CDS       T01606                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rhom172_0119
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_0119
  Lipid metabolism
   00071 Fatty acid degradation
    Rhom172_0119
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rhom172_0119
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rhom172_0119
   00626 Naphthalene degradation
    Rhom172_0119
Enzymes [BR:rmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rhom172_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
125323..126339
Genome map
AA seq 338 aa AA seqDB search
MTRALPATMRAMVLEAPGRPLVLRELPVPEPGPGEVLLRVEACGVCRTDLHIVDGELPAP
KLPLIPGHQIVGRVVRSGEGVTRFREGDRVGVPWLAETCGTCRYCRRGQENLCPNARFTG
YTRDGGFAEFTTALADYCYPLPDDVYDAPHAAPLLCAGLIGYRTYRLAGPHVERLGLYGF
GAAAHLIIQVAVARGQQVYAFTRPGDTAAQAFARKLGAVWAGASTERPPEPLDAALIFAP
VGALVVEALRSVDKGGVVVCGGIHMSDIPSFPYRLLWEERVIRSVANLTRQDGEEFLKLA
PTIPVRTEVTCFPLEEANEALRRLREGQLQGAAVLVMR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgcgttgcctgctaccatgcgggccatggtgctggaggcccccggacgtccg
ctcgtgcttcgcgaactgcccgtgcccgaacccggaccgggcgaagtgctgcttcgggtg
gaggcgtgcggcgtgtgccgcaccgatctgcatatcgtggacggcgagctgcccgcgcct
aaactgccgctgattccagggcatcagatcgtgggacgggtggtgcgatcgggtgaaggg
gtgacccgctttcgggagggcgaccgcgtgggcgtgccctggctggccgagacgtgcgga
acgtgccgctattgccgtcggggccaggaaaacctgtgcccgaacgcccgcttcaccggc
tacacgcgcgacgggggctttgccgaattcaccacggccctggccgactactgttatccg
ctcccggatgatgtgtatgacgcgcctcacgcggcaccgctgctgtgcgccgggttgatc
ggctaccgcacctaccggctggccgggccgcatgtcgagcgcctgggcctgtacggcttt
ggtgcggccgcgcatctgatcatccaggtggccgtggcccgcggccagcaggtttacgcc
ttcacccggcccggcgacacggccgcgcaggcgttcgcccggaagctgggggccgtctgg
gccggtgcttcgacggagcgtccgccggagccgcttgatgccgccctgattttcgcgccg
gtaggggcgctggtggtcgaggcgctccggtcggtagataaggggggggtagtggtgtgc
ggcggcatccacatgagcgacatcccgtcgttcccttaccgactgctctgggaggaacgc
gtcatccgctcggtggccaacctgacgcgtcaggacggcgaggaattcctgaagctggcg
cccaccattcccgtacgtaccgaggtgacgtgttttccgctggaagaggccaacgaggcg
cttcggcgactccgcgaaggccagctccagggcgccgccgtgctggtgatgcgatag

DBGET integrated database retrieval system