KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0141Help
Entry
Rhom172_0141      CDS       T01606                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rmg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
150389..151324
Genome map
AA seq 311 aa AA seqDB search
MWHPEAFDTDRFVLNCRGRLLDSRPGLPGGAHVMGILNVTPDSFWDGGRYQAVDAALKRV
ETMLEEGAAIIDVGGESTRPRGRTYGRGAEPVSPDEERRRVLPVIEAIAQRFPEAIISVD
TYKPEVARDALEAGAHLINDQTGLRLYPEMAEVAARYGAPLVLMHSVGRPGEMPHELHYD
DVAAEVRQSLAASVARAHAAGVRQVVLDPGFGFGKTAAENLQLINNVDALLSLGYPVLVG
ISRKSTIGQVLGTPEQPVPPEGRLYGTLGVTAVAVLRGATLVRAHDVRPTVEMLRLLAAT
LAQPRTELHAV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtggcatcctgaagcttttgatacggaccgattcgtgttgaactgtcgggggcggttg
ctggactctcggcccggcctgcccggcggcgcgcacgtgatgggcattctgaacgtgacg
cccgactcgttctgggacggcggccgttaccaggcggtggatgctgccctgaagcgggtg
gaaactatgctcgaagaaggggcggcgatcatcgatgtcgggggggaatcgacacggccg
cgcgggcgcacctacggtcggggcgccgagccggtttcgcccgacgaagagcggcgccgc
gtgcttccggtgatcgaggcgatcgcgcagcgttttcccgaagcgatcatttcggtcgat
acctacaagccggaggtggcgcgcgatgcgctggaggccggcgcgcacctgatcaacgat
cagaccggactccggctctatccggagatggccgaggtggctgcccgctacggcgcgccg
cttgtgctcatgcactcggtggggcgtccgggcgagatgccacacgagttgcactacgac
gacgtggcggccgaagtccggcaatcgctggccgcgtcggtcgcccgggcccacgccgcc
ggtgtgcgtcaggtggtgctcgatccgggctttggctttggcaagacggcggccgaaaac
ctgcagttgatcaacaacgtcgatgcgctcctgagtctggggtatcccgtgctggtgggc
atctcccgcaaaagcacgatcggtcaggtgctgggcacgcccgagcagcctgtcccgccc
gaagggcggctctacgggacgctgggggtgacggccgtggccgtgctgcgcggggccacg
ctggtgcgggcgcacgacgttcgccccactgtcgaaatgctgcggctgctggcggccacc
ctggcgcaaccgcgcactgaattgcacgctgtctga

DBGET integrated database retrieval system