KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0143Help
Entry
Rhom172_0143      CDS       T01606                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
Enzymes [BR:rmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rhom172_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
152146..152829
Genome map
AA seq 227 aa AA seqDB search
MIEDDPLYRRRRLRLVEALREKGIQDERVLEAIARVPRHLFVEPALRARAYDDVALPIGL
KQTISQPFTVAYQTQLLEVRPGDRVLEIGTGSGYQAAILCALGARVFTIERHRSLLERAL
ARLEALGYRVVARCGDGSQGWPAFAPFDGIVVTAGATEIPEALCAQLRVPEGDRPGGRLV
IPVGGSHQQRMVRVRCTGPGTYETETLHVFRFVPLVRERDEARRRQS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggacgatcccctgtaccgacggcggcgtctgcgtctggtggaggcgctgcgg
gagaagggcattcaggacgagcgcgtactggaggccatcgcccgggtgccccgtcatctg
ttcgtggaacccgccctgcgcgcccgtgcctacgacgatgtggcgttgccgatcggcctg
aagcagaccatttcgcaacccttcacggtggcctatcagacccagcttctggaggtgcgg
ccgggcgatcgcgtgctggagatcggcacgggcagcggctaccaggcggccatcctgtgc
gcgctgggggcccgcgtgttcacgattgagcggcatcggtcgctgctggagcgggccctt
gcccgcctggaggcgttgggctaccgggtggtggcccgctgtggcgacggctcgcagggc
tggccggccttcgccccgttcgacgggatcgtggtgacggccggcgcgacggaaatcccg
gaggctctgtgcgcgcagctccgggtgcccgagggcgatcgtcccggcggccgcctggtc
attccggtcggcggcagccaccagcaacgcatggtgcgcgtgcgctgcaccggacccggc
acgtacgagaccgaaacgctgcacgtcttccggttcgtgccgctcgtgcgcgagcgcgac
gaggcgcggcggcgtcagtcctga

DBGET integrated database retrieval system