KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0175Help
Entry
Rhom172_0175      CDS       T01606                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00790  Folate biosynthesis
rmg01100  Metabolic pathways
Module
rmg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rhom172_0175
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rhom172_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: AEN72123
UniProt: G2SED1
Position
187363..188025
Genome map
AA seq 220 aa AA seqDB search
MAKNKSTGVLVRSGAHLELDSHPIDHFERVDRYPAEATEAIQQHMREILRWIGEDPDREG
LRRTPERVALALQYLTQGYHQDPRAILESALFEEDYSEMILVRDIQIYSLCEHHLLPFFG
KAHVAYIPNKKIVGLSKIPRVVDVFARRLQVQERLTIQIRDALEEVLQPLGVAVVIEAQH
LCMMMRGVEKQHAITTTSAMSGEFLKEATRAEFMRLINGG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaataaatcgaccggcgtgctcgtgcgttcgggcgcccacctggagctggac
agccacccgatcgatcatttcgagcgggtggatcggtacccggccgaggcgaccgaagcc
attcagcagcacatgcgcgaaatccttcgctggatcggcgaggacccggatcgcgaaggg
ctccggcgcactccggagcgggttgcgctggcgctccagtacctgacgcagggatatcac
caggatccgcgcgccatcctggagtcggccctcttcgaggaagactacagcgagatgatc
ctggtgcgagatattcagatctattcgctctgcgagcatcacctcttgccgtttttcggc
aaagcgcatgtggcttacatcccgaacaaaaagatcgtcggactgagcaagattccccgt
gtggtggacgtgttcgcccggcggcttcaggtgcaggagcggttgacgattcagattcgg
gatgcgctggaagaggtgcttcagccgctgggcgtggccgtggtgatcgaggcgcagcac
ctgtgcatgatgatgcgcggcgtggaaaagcagcatgcgatcaccaccaccagcgcgatg
agcggtgaatttctgaaagaggccacgcgggccgagttcatgcggctgatcaacggaggg
tga

DBGET integrated database retrieval system