KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0192Help
Entry
Rhom172_0192      CDS       T01606                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rhom172_0192
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rhom172_0192
   00650 Butanoate metabolism
    Rhom172_0192
  Energy metabolism
   00190 Oxidative phosphorylation
    Rhom172_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
202753..203256
Genome map
AA seq 167 aa AA seqDB search
MAIQYGKTSRSYATNWFLHRITGTFLVFLLITHFWVQHYDAQTASVAAQVLSSEQIEAGA
LPDYPEAAKEAVRARYGPDAEVTPYDVVMLRLADPVYAVLWKGFNILFLIFALHHGFYGL
NNILTDYIRNPIGRVLAQTLSWTLALVLLIVGLYSIIVAGWGYMPAS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctatccagtacggcaagacgtcccgatcctatgcgacgaactggtttctgcaccgg
attaccgggacgtttctggtgtttctgctgatcacgcatttctgggtgcagcactacgat
gcgcagacggccagcgtggcggcccaggtgctctcgagcgaacagatcgaggctggcgcg
ctgcccgactatccggaggcggccaaagaggcggtgcgggcccgctatggtcccgacgcc
gaggtcacgccctacgacgtggtgatgttgcggctggccgatccggtctatgccgtgctc
tggaagggattcaacatcctgtttctgattttcgcgctgcatcacggattctacgggctc
aacaacatcctgaccgactacatccgcaatccgatcgggcgcgtgctggcccagacgctc
tcctggacgctggcgctggtgctgctcattgtggggctgtattccatcatcgtagccggt
tggggttacatgcctgcatcgtga

DBGET integrated database retrieval system