KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0277Help
Entry
Rhom172_0277      CDS       T01606                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rmg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rmg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rmg00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rmg00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rmg00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rmg00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rmg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
301748..302875
Genome map
AA seq 375 aa AA seqDB search
MPRRLRIGLLTGGGDCPGMNAVIRAVTKSLILQADAEVIGFEDGYEGLIEGRFRTLEFQD
VSGILTRGGTILGTSNRANPFRYYRRGEADVSAEVIALYRELELDGIVAIGGDGTMTIAH
GLSERGLRFIGVPKTIDNDIWGTERTFGFDTAVHIATEAIDRLHTTAQSHHRVMICETMG
RYAGWIALYAGVAAGADVILIPELPFDVEVVAEVCRERESDGRRFTIVVVAEGARPEGGS
FHVRERVPESPDPIRLGGIGYELERQLRERLRSEVRTTVLGHVQRGGTPTAYDRSLASAF
GAYAAALVQAEQYGCMVALRDGRLTTIPLAEVAGRTRTVPLDHPMLGAALAVGTSLGVRA
LTSPLVGAEPTAPLA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgacgtttacgcatcggcctgctgaccggcggcggcgattgcccgggcatgaac
gccgtcatccgcgccgtcaccaagagcctgatcctgcaggccgacgccgaggtgatcggc
ttcgaagacggctacgaaggactcatcgaaggtcgatttcggacgctcgaatttcaggac
gtcagcggtatcctgacgcggggcggtacgattctcggcacgagcaaccgggccaatccg
tttcgctactaccggcgcggcgaggccgacgtgtcggccgaagtcatcgcgctgtaccgc
gagctggagctggacggcatcgtggccatcggcggcgacggcacgatgacgatcgcccat
gggctttcggagcgtgggcttcgtttcatcggcgtgcccaagacgatcgacaacgacatc
tggggtaccgagcgcaccttcgggtttgatacggccgtgcacatcgccacggaggcgatc
gaccggctccacacgacggcgcagagccaccaccgcgtgatgatctgtgagacgatgggg
cgttatgccggatggatcgcgctgtatgcgggcgtggcggctggcgccgacgtaattctg
attcccgagctgcccttcgacgtggaggtggtggccgaggtgtgccgtgagcgcgaaagc
gacggccgtcgctttacgatcgtcgtggtggccgagggggcgcgtcccgaagggggctcc
ttccacgtgcgggagcgcgtgcccgaaagccccgacccgatccggctgggcgggatcggc
tacgaactggagcgtcagcttcgcgagcggttgcggagcgaggtgcgcactaccgtgctg
ggccacgtgcagcggggcggcacgcccacggcctacgaccgcagcctggcttcggccttc
ggggcctatgcggccgcactggtgcaggccgagcagtatggctgcatggtggcacttcgc
gacggccgactgaccaccattccgctggccgaggtggccggacgcacacgcaccgtgccg
ctcgaccatcccatgctgggggccgcactggccgtgggtacgtcgctgggcgtccgggcc
ctgacctcgccgctggtgggcgccgagccgaccgcgccgctggcctga

DBGET integrated database retrieval system