KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0333Help
Entry
Rhom172_0333      CDS       T01606                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rmg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rmg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
366902..367444
Genome map
AA seq 180 aa AA seqDB search
MSLLLSVTSRRPEIVLIAALAEKNRVIGRNGRLPWHLPEDLRRFKRLTMGHPLLMGRKTF
ASLLEEFGGPLPGRRHLVLSRSRTYPGLASVEVYPDVEAALKAVGDVPVLFIAGGAEVYA
QFLPRADRLELTLVEGDYEGDTFFPPYEHLIGPVFEEVAVERHPDFRFVTYRRRPDAPKP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcttttatcggtaacatccagacgtccggagattgtgttgattgcggcgctg
gccgaaaagaaccgggtgatcgggcgcaacgggcggcttccgtggcatctgccggaggac
ctgcggcgcttcaagcggctgacgatgggacatccgctgctgatggggcgcaagacgttc
gcgtcgctgctggaagaattcggtgggcccctgcccggccggcgacatctggtgctttcg
cggagccggacctatccggggctggcaagcgtcgaggtgtacccggacgtcgaggcggcg
ctgaaggccgtgggcgacgtgcccgtgctgttcattgcgggcggcgccgaggtgtatgcc
cagtttctaccccgggccgatcggctggagctgacgctcgtcgagggcgactacgagggc
gatacgttctttccaccctacgaacacctgatcgggcctgtcttcgaggaagtagccgtc
gagcggcatccggactttcggttcgtcacctaccggcgacgtcctgacgcaccgaagccg
taa

DBGET integrated database retrieval system