KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0433Help
Entry
Rhom172_0433      CDS       T01606                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rmg00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rmg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
483199..484350
Genome map
AA seq 383 aa AA seqDB search
MVNAQTFHSICRWTFNAGKGGFVPANVRPAWAADRFGTVEFIYLVKEKIAPRLPDTITLG
VELHYDNEINEQNAEAVAKALAETGLHLAMITPGAHIHFGYGGICSLDPKERAAAEELGR
RTVELAYGPLRKVWHPDPDRAPTLVIWNGSFGYDLATVGVRQMYRNLKESLARLCQLEQE
KGGLMYIGIEPKPNEGHPAMLLPTVASALLIWRQLADEFGIDRSKKGVNMEIGHSEMIGL
DAVYDVVEQLEERAMVHFHLNSQGYNDGIILGGPGRYDIDHGTRVNGMNIALAGLLEQDG
YNRWLGHDMQPRPYDNEEQAIDRVVRSILSWEACRRAAQQLDVSELLALLARRETARAED
LMRAALVEAQRQFDALYEPTVSA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacgcacagaccttccacagcatctgtcgctggacgttcaatgcgggcaagggc
ggcttcgtcccggccaacgttcgtccggcctgggcggccgatcgcttcggcacggtcgag
ttcatctatctggtgaaagaaaagattgcaccacgcctgcccgacacgatcacgctgggc
gtcgagctgcactacgacaacgaaatcaacgagcagaacgccgaggcggtcgcgaaggcg
ctggccgagaccgggctgcatctggcgatgatcacgccgggcgcccatattcatttcggc
tatggcggcatctgctcgctcgatccgaaggagcgggcggccgccgaagaactgggccgg
cgcacggtggagctggcctacggtccgctgcgcaaggtctggcatccggaccccgacaga
gcgcccacgctggtcatctggaacggctcgttcggctacgacctggccacggtgggggtg
cgccagatgtaccgtaacctgaaggaaagtctggcgcgcctctgccagctcgagcaggaa
aaaggcgggctcatgtacatcggcatcgagcccaagccgaacgaaggacatccggccatg
ctgttgccgaccgtggccagtgcgctgctcatctggcgccagctcgccgacgagttcggc
atcgatcggtcgaagaaaggagtcaacatggaaatcggtcactcggagatgatcggcctc
gatgccgtttacgatgtggtggagcagctcgaagaacgggccatggtccatttccacctg
aacagccagggctacaacgatggtatcattctgggcggtccggggcgctacgacatcgac
cacggcacgcgcgtcaacggcatgaacatcgcgctggccggtctgctggagcaggacggg
tacaatcgctggctcgggcacgacatgcagccccggccctacgacaacgaggagcaggcc
atcgatcgcgtggtgcgcagcattctgagctgggaagcctgccgccgcgccgcgcagcag
ctcgacgtgtcggagctgctggcgctgctggcccggcgcgagacggcccgcgccgaagat
ctgatgcgggcggcgctggtcgaggcgcagcgtcagttcgacgcgctctacgagccgacc
gtcagcgcctga

DBGET integrated database retrieval system