KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0471Help
Entry
Rhom172_0471      CDS       T01606                                 

Definition
Aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_0471
   00052 Galactose metabolism
    Rhom172_0471
Enzymes [BR:rmg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Rhom172_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
524945..526096
Genome map
AA seq 383 aa AA seqDB search
MRTFWLVLCGGLLFGCQPSSNETPSPVETTTVTVTEESFGQLPDGRPVTLFRLRNASGME
VEVLNYGAIIRAIRVPDREGNRGDVVLGFDSLAAYLQPHPYIGAVVGRYANRIGGARFVL
DGQPYELAANDGPNHLHGGLKGFDKVLWEAEPFTNGNEAGVRLTYVSPDGEEGYPGTLRA
TVTYTLADSNALVIDYEATTDKPTIVNLTQHAYFNLAGRGDILNHELQLLADFYTPVDER
LIPTGEICPVAGTPLDFRTPQRIGARIDTDHEQIRRGRGYDHNFVLRHTERGALELAARV
YEPTSGRIMRVYTTEPGIQFYSGNFLDGSLTGKGGMVYGRRTGFCLETQHFPDSPNKTHF
PSPVLRPGETYRSRTVYAFDVAE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacgttctggctcgtactctgcggggggctgctgtttggttgtcagccttcgtcc
aacgaaaccccttcgcctgtggaaacgacaacggtaaccgtcaccgaggaatcgtttggc
cagttgcccgacggacgacccgtcacgcttttccggctacgcaatgccagcgggatggaa
gtcgaagtcctgaattacggggcgatcatccgcgccattcgggtgcccgatcgcgagggg
aacaggggcgatgtggtgctgggctttgacagtcttgcggcctatctgcaaccccatccc
tacatcggcgcggtggtcggtcgctatgccaaccgtatcggcggcgctcgcttcgtgctc
gacggccagccctacgagctggcggccaacgatgggcccaaccacctgcacggtggactg
aaagggttcgacaaggtgctctgggaagccgagccgttcacgaacgggaacgaggccggc
gtgcgccttacgtacgtgagtcccgacggcgaggagggctatccgggcacgctgcgggcg
acggtcacctacacactggccgactcgaacgcgctggtgatcgactacgaggcgaccacc
gacaaacccaccatcgtcaacctgacgcagcatgcctacttcaacctggccggtcgcggg
gacatcctgaaccatgagctgcagctcttggccgatttctacacgcccgtggacgagcgg
ctgattcctaccggcgagatatgcccggtggcgggcacgccgctggactttcgcaccccg
cagcgcatcggcgcccgcatcgacaccgaccacgagcagatccgccgtggccgcggctac
gatcacaacttcgtgctgcgccacaccgaacgcggcgcgctggagctggccgcccgcgtc
tacgaacccaccagcggccgcatcatgcgcgtctacaccaccgagccgggcattcagttc
tacagcggcaactttctggatggctcgctgaccggcaagggtggcatggtgtacggccgg
cgcaccggcttctgtctggagacgcagcattttccggattcgcccaacaagacgcatttt
ccgtcgccggtgctgcgtccgggtgagacctaccgctcgcgtacggtctacgccttcgac
gtggccgagtag

DBGET integrated database retrieval system