KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0544Help
Entry
Rhom172_0544      CDS       T01606                                 

Definition
Lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rhom172_0544
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rhom172_0544
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rhom172_0544
Lipid biosynthesis proteins [BR:rmg01004]
 Fatty acid synthase
  Component type
   Rhom172_0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(623320..624078)
Genome map
AA seq 252 aa AA seqDB search
MHRFDLLITDPIDSVLKLLLPLLLMLLAACGGASEPPRSEASPDTTAPAARDTARAERTI
NVLVLGNSLAAGYGLSPDEAFPAVLQRKVDSLGWPVRIINAGLSGETSAGGLRRIEWLLR
ERIDVLILELGANDGLRGIDPEVTRRNLQGIIDSVRARYPDADIILAGMQLPPNLGPDYT
AAFRAIYPELARANDAHLIPFLLEGVGGVPELNQADGIHPTAEGQRIVAENVWRVLRPVL
ERQLSRPIRNVS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcacagattcgacctccttataaccgatccgatcgattcggttctgaagctcctgctt
ccgctgcttctcatgttgctggccgcctgcggcggcgcgtccgaaccgccccgatccgaa
gcttcgccggatacgacggccccggccgcccgcgacaccgcccgtgcggagcgcacgatc
aacgtgcttgtgctgggcaacagtctggccgccggctacggcctgtcgcctgacgaagcc
tttccggccgtgttgcagcgtaaagtggattcgctgggatggcccgtgcgcatcatcaac
gccgggctgagcggcgagacctcggccggtggtctgcgccgcatcgagtggctgctccgc
gaacgcatcgacgtgctcattctggaactgggtgccaacgacgggctgcgcggcatcgac
cccgaagtgacgcgccgcaacctgcagggcatcatcgacagcgtgcgcgcccgctatccg
gacgccgacatcatcctggccggcatgcaactgcccccgaacctgggccccgactacacg
gccgccttccgcgccatctatcctgaactggcccgcgccaacgacgcccatctgattccc
ttcctgctcgaaggcgtcggaggcgtgcccgagctcaaccaggccgacggcattcatccc
acggccgaaggtcagcgcatcgtagccgaaaacgtctggcgtgtgctgcgccccgtactg
gagcgacagctttcccggccaattcgaaacgtctcgtga

DBGET integrated database retrieval system