KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0626Help
Entry
Rhom172_0626      CDS       T01606                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rhom172_0626
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rhom172_0626
Enzymes [BR:rmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rhom172_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(709756..711042)
Genome map
AA seq 428 aa AA seqDB search
MRQPIAAVKAARLEAEWRSNPRWAGIRRPYAAEEVLRLRGSVEIAYTLADRGARRLWELL
HTEPYVAALGALTGNQAMQQVKAGLKAIYVSGWQVAADANLAGQMYPDQSLYPSNSVPAL
VRRINNTLLRADQIHHAEGDDSIDWLVPIVADAEAGFGGPLHAFELTKALIEAGAAGVHF
EDQLASEKKCGHLGGKVLVPTGQFIQTLVAARLAADVMGVPTIIIARTDANAATLLTSDI
DERDRPFLTGERTPEGFFRVRAGLDQAIARALAYAPYADMIWCETSTPDLEEARCFAEAI
HREYPGKLLAYNCSPSFNWKKHLDEATIARFQRELAAMGYKFQFITLAGFHTLNYAMFEL
AYDYAHEGMPAYVRLQQKEFAAMEKGFTAVRHQREVGTGYFDAVRTVITGEQASTVALAG
STETQQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaccgattgccgccgtcaaagccgcccgtctcgaagccgaatggcgctccaat
ccccgatgggccgggatccgccgaccctacgccgccgaagaggtgctccgccttcgcggc
tcggtcgaaatcgcctatacgctggccgaccgcggcgcccggcgcctctgggaactgctc
cacaccgaaccctacgtggccgcgcttggcgccctgaccggcaaccaggccatgcaacag
gtcaaagccggcctcaaagccatctacgtcagcggctggcaggtggccgccgacgccaac
ctggccggtcagatgtaccccgaccagagcctctacccctccaacagcgtcccggccctc
gtgcgccgcatcaacaacacgctgctgcgcgccgaccagattcaccatgccgaaggcgac
gactcgatcgactggctcgtgcccatcgtggccgacgccgaggccggcttcggcggcccg
ctccatgccttcgagctgaccaaggcgctcatcgaagccggtgccgccggggtccacttc
gaggaccagctcgcctccgaaaagaaatgcggccacctgggcggcaaggtgctcgtcccc
accggccagttcatccagaccctggtcgccgcccgcctggccgccgacgtcatgggcgtg
cccaccatcatcatcgcccgcaccgacgccaacgccgccacgctgctcaccagcgacatc
gacgagcgggaccgccccttcctcaccggcgaacgcacgcccgaaggctttttccgcgtc
cgtgccgggctcgatcaggccatcgcccgcgccctggcctacgcgccctacgccgacatg
atctggtgcgagacgtccacgcccgacctggaagaagcccggtgcttcgccgaggccatc
caccgcgaataccccggcaaactgctggcctacaactgctcgccgtcgttcaactggaag
aagcatctcgacgaggccaccattgcccgtttccagcgggagctggccgcgatgggctac
aaattccagttcatcacgctggccggcttccacacgctcaactacgccatgttcgaactg
gcctacgactatgcgcacgaaggtatgccggcctacgtgcgcctgcagcagaaggagttt
gccgccatggagaagggctttacggccgtgcggcatcagcgcgaggtgggcaccggctac
ttcgacgccgtgcggacggtgatcaccggtgagcaggccagcacggtggccctggccggt
tccaccgagacgcagcagttccactga

DBGET integrated database retrieval system