KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0796Help
Entry
Rhom172_0796      CDS       T01606                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rhom172_0796
Enzymes [BR:rmg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rhom172_0796
Peptidases [BR:rmg01002]
 Cysteine Peptidases
  Family C44
   Rhom172_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(906326..907651)
Genome map
AA seq 441 aa AA seqDB search
MMRPRYIEDVIDLTDPALNHILNMSVEEARARVRSGDPKAVRAIEGSFALVARDGKTVRL
ARSMDRPMRYFLAKREDGPALVVAHRIEEIHRWLQSVGFADQFHPNYTRMVPAHYVVTLE
LIGCPDPAPAYTRFFEIPTETLPPDLPTIGRYYIGALKEEIRRWLLSIPEDEPIGVTFSG
GIDSGSVFLVTYHTLLELGMNPGRLKAFTLDLGDGPDRNQAFTFLQKLGLELFWEPVEAG
PELIDIREVVRLVEDYKPLDIESAAMHYALARALRQRYPDWKYLLDGEGGDENLRAYPIE
HNPELTVYSIINNHLLYHEGWGVDKFKHSITYTGGLSRAYTRTFAINRHFGFEGFSPYTR
PNVIEVAEKIPFAELTGYDKEKLYRLKGEVVYHGVRAVTGFEMPVFEKRRFQHGALPEAR
LRELIPPERQLRRMVEDLFVS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtccccggtacatcgaagacgtgatcgatctgaccgatccggcgctgaaccat
attctgaacatgtcggtcgaagaggcccgcgcccgtgtgcgctcgggcgacccgaaggcg
gtgcgggccatcgagggctcgttcgcgctggtggcccgcgacggcaaaacggtgcgtctg
gcccgctcgatggaccgccccatgcgctactttctggccaagcgggaggacggccccgcg
ctggtcgtggcccaccgcatcgaggagatccaccgctggctgcaatcggtcggttttgcc
gatcagtttcatccgaactacacgcgcatggtgcccgcccactacgtggtcacgctggag
ctgatcggctgtccggatccggcgcccgcctacacccgcttctttgaaattcctaccgaa
acgctgccccccgaccttcccaccatcggacgctactacatcggcgcgctcaaggaagaa
atccgacgctggctgctgagcattcccgaagacgagcccatcggtgtgacgttttcaggc
ggcatcgacagcggctcggtctttctggtcacctaccacacgctgctggagctgggcatg
aaccccggccgactcaaagcctttacgctggacctgggcgacggccccgaccgcaaccag
gcctttacgtttctacagaagctcggcctggagctgttctgggagcccgtggaagcgggt
ccggagctgatcgacatccgagaagtggtgcgcctcgtcgaggactacaagccgctcgac
atcgagtcggccgccatgcactatgcgctggcccgcgccctgcgccagcgctatccggac
tggaagtacctgctcgacggcgagggcggcgacgagaacctccgcgcctatcccatcgag
cacaacccggaactgaccgtttacagcatcatcaacaatcacctgctctaccacgaaggc
tggggcgtggacaaattcaagcactcgatcacctacacgggcggcctcagccgcgcctac
acgcgcaccttcgccatcaaccggcacttcggcttcgagggcttcagcccctacacgcgc
ccgaacgtgatcgaagtggccgaaaagattccctttgccgagctgaccggctacgacaaa
gaaaagctctaccgcctcaaaggcgaggtggtctatcacggcgtccgagccgtcaccggc
ttcgaaatgcccgtgttcgaaaaacgacgcttccagcacggtgccctgcccgaagcgcgg
ttgcgcgaactgattccgcccgaacgtcagctccggcgcatggtggaggacctgttcgtc
tcatga

DBGET integrated database retrieval system