KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0956Help
Entry
Rhom172_0956      CDS       T01606                                 

Definition
(GenBank) Trans-hexaprenyltranstransferase
  KO
K02523  
octaprenyl-diphosphate synthase [EC:2.5.1.90]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rhom172_0956
Enzymes [BR:rmg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.90  all-trans-octaprenyl-diphosphate synthase
     Rhom172_0956
Prenyltransferases [BR:rmg01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Rhom172_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1085674..1086678)
Genome map
AA seq 334 aa AA seqDB search
MAVRATPPDQPRVISLKDIQRPVAEELKHFQRYFRDAMRTSVPLLDHVARYLLRQKGKRI
RPLLVLLTAKLCGGITEATYRAAALVELLHSATLVHDDVVDGAEQRRGMFSINAIWKNKV
AVLFGDFLLSRGLLLALDHRDYDTLHALSDAVRRMSEGELLQIEKSRHLDIDEATYFRII
SDKTASLIAACTKSGALSATDDPRVIDEMYLMGEKLGLAFQIRDDLFDYGEEAGKPIGND
LKEKKLTLPLIYALRMAPSSERRRILRIVRKKKKSRDDIQTVADFAEAYGGMAYARERME
ALAGEARTILERYPPGDARDALLDLVDYTVTRNR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcgtgctacccccccggatcaaccgcgtgtcatctccctgaaagacatccag
cgccccgttgcggaagagctgaagcacttccagcgctacttccgcgatgccatgcgcacc
tcggtgccgctgctcgatcacgtcgcccgctacctgctccgccagaaagggaagcgcatc
cgcccgctgctggtcctgctgacggccaaactgtgcggcggcatcacggaagccacctac
cgggccgcggccctggtggaactgctgcactcggccacgctggtgcacgacgacgtggtg
gacggcgccgagcagcgccgcggcatgttttccatcaacgccatctggaaaaacaaggtg
gccgtgctcttcggcgactttctgctcagccggggcctgctgctggcgctggaccaccgg
gactacgacacgctgcacgcgctgtcggacgccgtgcgccgcatgagcgaaggcgaactg
ctgcagatcgaaaagtcgcgccacctggacatcgacgaagccacctacttccgcatcatt
tccgacaagaccgcctcgttgatcgccgcctgcaccaaatccggggccctcagcgccacc
gacgatccccgggtgatcgacgagatgtatcttatgggcgaaaagctggggctggctttc
cagatccgcgacgacctgttcgactacggcgaagaggccggcaaacccatcgggaacgac
ctgaaggagaaaaagctgacgttgccgctcatctacgcgctccggatggcaccgtcttcc
gagcgccgccgcatcctccggatcgtgcgcaaaaagaaaaagtcgcgcgacgacattcag
acggtggccgactttgccgaggcatatggcggcatggcctacgcccgagagcgtatggaa
gcgctggccggtgaagcgcggaccattctcgaacgctacccgcccggcgacgcccgcgac
gcgctcctcgacctggtggactacaccgtcacgcgcaatcggtaa

DBGET integrated database retrieval system