KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0957Help
Entry
Rhom172_0957      CDS       T01606                                 

Definition
(GenBank) sodium:neurotransmitter symporter
  KO
K03308  
neurotransmitter:Na+ symporter, NSS family
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1086835..1088343
Genome map
AA seq 502 aa AA seqDB search
MQETRQHFSSRLGLLLSVLGIAVGTGNIWRFPRIAAQNGGDLGAGAFLLVWVVFLFLWSV
PLIVAEYALGQKGRMGVIGTFARVGGRSMAWLGAFVALVSTAIMCYYAVVTGWCLYYAGG
LLLRPLPGSTEAAQQFWGGFQGSLWPVVFQALALALAVAVIWTGVRAIERANRFLIPSLL
VILLVALVRALTLEGAFEGVRYLFTPQWSDLARPRLWLEALTQNAWDTGAGWGLILTYAA
YMRREHGVVQNAFLTGVGNNTVSLLAALTIFGTVFAVLGVELSRAEVLEVMRTSGPASTG
LTFIWLPQLFARMPMGRVLAVLFFVGLTFAAFSSLIAMVELATRVLMDLGLRRSRALVGV
GVVAWLLGLPSALNLTVFGNQDFVWGVALMLSGAFVALAVMRYGPARLRAETIAVNAWDW
QLGRGWDVLMRWVVPLEAVVLLGWWLYQAGVVYAPERWYDPFVPYSVMTCLVQWGVALVA
CYLLNDWLVRRMQLLIPVQTEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaacgcgacagcatttctcttcgcggctggggttgctgctgagcgtgctgggg
atcgcggtggggacgggcaacatctggcgttttccccgcattgccgcccagaatggcggc
gacctgggcgccggggcttttctgctggtgtgggtggtgtttctgtttctctggagcgtg
ccgctgatcgtggccgagtatgcgctggggcagaaaggccggatgggggtgatcgggacg
ttcgcgcgtgtgggcgggcgctcgatggcctggctgggcgcgttcgtggcgctggtctcg
acggccatcatgtgctactatgcggtcgtgacgggctggtgcctgtactacgccggagga
ctgctgctcaggccgttgccgggttcgacagaagcggcgcagcagttctggggcgggttt
caggggagtctctggccggtggtgtttcaggcgctggcgctcgcgctggccgtggcggtg
atctggacgggcgtgcgggccatcgagcgggccaatcggtttctgatcccgtcattgctg
gtaattctgctggttgcgctggtgcgggcgttgacgctggagggggccttcgagggggtg
cgctatctgttcacgccacagtggagcgatctggcgcggccgcggctgtggctggaggcg
ctcacgcagaacgcctgggacacgggcgcgggctgggggttgattctgacctacgcggcc
tacatgcggcgtgagcacggcgtggtgcagaatgcgtttctgacgggcgtgggcaacaac
acggtgtcgcttttggcggcgctgacgatcttcgggacggtgttcgcggtgctgggggtg
gagctgtcgcgggccgaggtgctggaggtgatgcgcacaagcggtccggcttcgacgggg
ctgacgttcatctggttgccgcagctttttgccagaatgccgatgggtcgggtgctggcc
gtgttgtttttcgtggggttgacgttcgcggccttcagttcgctgattgcgatggtggag
ctggccacgcgcgtgttgatggacctggggcttcggcggtcgcgggcgctggtgggggtg
ggcgtggtggcctggctgctggggttgccctcggcgctgaacctgacggtgttcggtaat
caggattttgtctggggcgtggcgttgatgctttcgggtgcgtttgtggcgctggcggtg
atgcgctacggtccggcgcgtttgcgggcggagacgattgcggtgaatgcgtgggactgg
caactggggcggggctgggatgtgctgatgcggtgggtggtgccgctggaggcggtggtg
ctgctgggctggtggttgtatcaggcaggggtggtgtatgcgccggagcggtggtacgac
ccgtttgtgccctattcggtgatgacgtgtctggtgcagtggggcgtggcgctggtggcc
tgctatctgctcaacgactggctggtgcgtcggatgcagcttctgatcccggtgcaaaca
gaagaatga

DBGET integrated database retrieval system